Gene/Proteome Database (LMPD)

LMPD ID
LMP013592
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
cerberus 1, DAN family BMP antagonist
Gene Symbol
Synonyms
RGD1563046;
Alternate Names
cerberus; cerberus 1, cysteine knot superfamily, homolog;
Chromosome
5
Map Location
5q31

Proteins

cerberus precursor
Refseq ID NP_001108503
Protein GI 169234812
UniProt ID B0BN87
mRNA ID NM_001115031
Length 267
MHLLFLQLIVLLPLGKAGLCVDDCQSQGSFSFALPERGRRDLHMVNHEEAEDKPDLFVAVPHLMGTSSAREGQRQREKMLSRLGRFWKKPEAELYPTRDMESDHVLSGIQALTQPADVRKLERSPLQEEAKKFWHRFMFRKGPASQGVILPIKSHEVHWETCRTVPFNQTIAHEDCQKVTVQNNLCFGKCGSIHFPGEGAHPHNFCSHCSPTKFTTTHLRLNCTSPTPVVKMVIQVEECQCMVKTEHGEERRLLAGSQDSFISGLPA
sig_peptide: 1..17 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1919 peptide sequence: MHLLFLQLIVLLPLGKA

Gene Information

Entrez Gene ID
Gene Name
cerberus 1, DAN family BMP antagonist
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IEA:Ensembl C extracellular space
GO:0016015 IEA:Ensembl F morphogen activity
GO:0009948 IEA:Ensembl P anterior/posterior axis specification
GO:0030282 IEA:Ensembl P bone mineralization
GO:0042074 IEA:Ensembl P cell migration involved in gastrulation
GO:0071773 IEP:BHF-UCL P cellular response to BMP stimulus
GO:0048263 IEA:Ensembl P determination of dorsal identity
GO:0003419 IEA:Ensembl P growth plate cartilage chondrocyte proliferation
GO:0032926 IEA:Ensembl P negative regulation of activin receptor signaling pathway
GO:0008285 IEA:Ensembl P negative regulation of cell proliferation
GO:2000381 IEA:Ensembl P negative regulation of mesoderm development
GO:0007399 IEA:Ensembl P nervous system development
GO:0035582 IEA:Ensembl P sequestering of BMP in extracellular matrix
GO:0023019 IEA:Ensembl P signal transduction involved in regulation of gene expression
GO:0001657 IEA:Ensembl P ureteric bud development

KEGG Pathway Links

KEGG Pathway ID Description
ko04310 Wnt signaling pathway
rno04310 Wnt signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
5953533 Developmental Biology
5954413 Regulation of signaling by NODAL
5953381 Signal Transduction
5954020 Signaling by BMP
5953829 Signaling by NODAL

Domain Information

InterPro Annotations

Accession Description
IPR016860 Cerberus
IPR006207 Cys_knot_C
IPR004133 DAN

UniProt Annotations

Entry Information

Gene Name
cerberus 1, DAN family BMP antagonist
Protein Entry
B0BN87_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013592 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
169234812 RefSeq NP_001108503 267 cerberus precursor

Identical Sequences to LMP013592 proteins

Reference Database Accession Length Protein Name
GI:169234812 GenBank EDM10464.1 267 rCG55280 [Rattus norvegicus]
GI:169234812 GenBank AAI58727.1 267 RGD1563046 protein [Rattus norvegicus]

Related Sequences to LMP013592 proteins

Reference Database Accession Length Protein Name
GI:169234812 GenBank AAB71838.1 272 cerberus-like [Mus musculus]
GI:169234812 GenBank AAI32432.1 272 Cerberus 1 homolog (Xenopus laevis) [Mus musculus]
GI:169234812 GenBank EDM10464.1 267 rCG55280 [Rattus norvegicus]
GI:169234812 GenBank AAI58727.1 267 RGD1563046 protein [Rattus norvegicus]