Gene/Proteome Database (LMPD)

LMPD ID
LMP013597
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
apolipoprotein F
Gene Symbol
Alternate Names
apolipoprotein F; apo-F; liver regeneration-related protein LRRG151;
Chromosome
7
Map Location
7q11

Proteins

apolipoprotein F precursor
Refseq ID NP_001019522
Protein GI 66730497
UniProt ID Q5M889
mRNA ID NM_001024351
Length 308
MGAQLLTCTVSDSIRHQFSCFATSCCVLWVPKGVSTMLPPSQLGSQPPTSDPLSCQALLPRSLPGFTHMPPLSKFLVGLALRNALEEAGCWADVWALQLQLYRFGGVEATQALIRHLQELQKGGRADWKVSVNALSSALQLLAWEQAGPKRVKRSLSNMGCENEQEQRVHNVVELLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSGGPTGAVITAALKPALKAGVQRLIRYYHDEEGVTTSQPETRKDAPTYRDDVEETTMSNLVSEVESTTSNWGRPLLKNYVFLAYKR
mat_peptide: 155..308 product: Apolipoprotein F experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5M889.1) calculated_mol_wt: 17075 peptide sequence: SLSNMGCENEQEQRVHNVVELLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSGGPTGAVITAALKPALKAGVQRLIRYYHDEEGVTTSQPETRKDAPTYRDDVEETTMSNLVSEVESTTSNWGRPLLKNYVFLAYKR

Gene Information

Entrez Gene ID
Gene Name
apolipoprotein F
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0034364 IEA:UniProtKB-KW C high-density lipoprotein particle
GO:0034362 IEA:UniProtKB-KW C low-density lipoprotein particle
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0008203 IEA:UniProtKB-KW P cholesterol metabolic process
GO:0006641 IEA:Ensembl P triglyceride metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR026114 Apolipoprotein F

UniProt Annotations

Entry Information

Gene Name
apolipoprotein F
Protein Entry
APOF_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Minor apolipoprotein that associates with LDL. Inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Also associates to a lesser degree with VLDL, Apo-AI and Apo-AII (By similarity)
Subcellular Location Secreted .

Identical and Related Proteins

Unique RefSeq proteins for LMP013597 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
66730497 RefSeq NP_001019522 308 apolipoprotein F precursor

Identical Sequences to LMP013597 proteins

Reference Database Accession Length Protein Name
GI:66730497 GenBank AAH88170.1 308 Apolipoprotein F [Rattus norvegicus]
GI:66730497 GenBank EDL84878.1 308 similar to apolipoprotein F [Rattus norvegicus]
GI:66730497 SwissProt Q5M889.1 308 RecName: Full=Apolipoprotein F; Short=Apo-F; AltName: Full=Liver regeneration-related protein LRRG151; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP013597 proteins

Reference Database Accession Length Protein Name
GI:66730497 GenBank AAP92630.1 240 Ba1-666 [Rattus norvegicus]
GI:66730497 GenBank AAH88170.1 308 Apolipoprotein F [Rattus norvegicus]
GI:66730497 GenBank EDL84878.1 308 similar to apolipoprotein F [Rattus norvegicus]
GI:66730497 SwissProt Q5M889.1 308 RecName: Full=Apolipoprotein F; Short=Apo-F; AltName: Full=Liver regeneration-related protein LRRG151; Flags: Precursor [Rattus norvegicus]