Gene/Proteome Database (LMPD)

LMPD ID
LMP013609
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Gene Symbol
Synonyms
Prey; Pyurf;
Alternate Names
protein preY, mitochondrial;
Chromosome
4
Map Location
4q24

Proteins

protein preY, mitochondrial precursor
Refseq ID NP_001019541
Protein GI 66730545
UniProt ID Q5U1Z8
mRNA ID NM_001024370
Length 112
MLTTTCRRLSQALQRPHALSAVAQRCLRAPGARSYADQNEKAEQPRTFHPALLQFLVCPLSKKPLRYDASTNELINDELGIAYPIIDGVPNMIPQAARTTRQKEKQEETKQH
transit_peptide: 1..34 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q5U1Z8.1) calculated_mol_wt: 3721 peptide sequence: MLTTTCRRLSQALQRPHALSAVAQRCLRAPGARS mat_peptide: 35..112 product: Protein preY, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q5U1Z8.1) calculated_mol_wt: 8949 peptide sequence: YADQNEKAEQPRTFHPALLQFLVCPLSKKPLRYDASTNELINDELGIAYPIIDGVPNMIPQAARTTRQKEKQEETKQH

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 ISS:HGNC C endoplasmic reticulum membrane
GO:0000506 ISS:HGNC C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0006506 ISS:HGNC P GPI anchor biosynthetic process
GO:0009893 ISS:HGNC P positive regulation of metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR005651 Uncharacterised protein family UPF0434/Trm112

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Protein Entry
PREY_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Similarity Belongs to the PREY family
Similarity Contains 1 TRM112 domain
Subcellular Location Mitochondrion .

Identical and Related Proteins

Unique RefSeq proteins for LMP013609 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
66730545 RefSeq NP_001019541 112 protein preY, mitochondrial precursor

Identical Sequences to LMP013609 proteins

Reference Database Accession Length Protein Name
GI:66730545 GenBank AAH86361.1 112 Phosphatidylinositol glycan anchor biosynthesis, class Y [Rattus norvegicus]
GI:66730545 GenBank EDL88035.1 112 similar to RIKEN cDNA 2610022G08, isoform CRA_a [Rattus norvegicus]
GI:66730545 SwissProt Q5U1Z8.1 112 RecName: Full=Protein preY, mitochondrial; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP013609 proteins

Reference Database Accession Length Protein Name
GI:66730545 GenBank AAH86361.1 112 Phosphatidylinositol glycan anchor biosynthesis, class Y [Rattus norvegicus]
GI:66730545 GenBank EDL88035.1 112 similar to RIKEN cDNA 2610022G08, isoform CRA_a [Rattus norvegicus]
GI:66730545 GenBank EDL88036.1 161 similar to RIKEN cDNA 2610022G08, isoform CRA_b [Rattus norvegicus]
GI:66730545 SwissProt Q5U1Z8.1 112 RecName: Full=Protein preY, mitochondrial; Flags: Precursor [Rattus norvegicus]