Gene/Proteome Database (LMPD)
Proteins
shadow of prion protein precursor | |
---|---|
Refseq ID | NP_001027015 |
Protein GI | 73661200 |
UniProt ID | Q5BIV7 |
mRNA ID | NM_001031845 |
Length | 147 |
MNWTTATCWALLLATAFLCDSCSAKGGRGGARGSARGVRGGARGASRVRVRPAPRYSSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSGSGSVHSPRICLLLSGTLGALELLRP | |
sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2594 peptide sequence: MNWTTATCWALLLATAFLCDSCSA mat_peptide: 25..122 product: shadow of prion protein calculated_mol_wt: 9563 peptide sequence: KGGRGGARGSARGVRGGARGASRVRVRPAPRYSSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG |
Gene Information
Entrez Gene ID
Gene Name
shadow of prion protein homolog (zebrafish)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0031225 | IEA:UniProtKB-KW | C | anchored component of membrane |
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0005730 | IEA:Ensembl | C | nucleolus |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0031982 | IEA:Ensembl | C | vesicle |
GO:0003676 | IEA:Ensembl | F | nucleic acid binding |
GO:0006606 | IEA:Ensembl | P | protein import into nucleus |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR029238 | Shadoo |
UniProt Annotations
Entry Information
Gene Name
shadow of prion protein homolog (zebrafish)
Protein Entry
SPRN_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Function | Prion-like protein that has PrP(C)-like neuroprotective activity. May act as a modulator for the biological actions of normal and abnormal PrP (By similarity) |
Ptm | N-glycosylated |
Similarity | Belongs to the SPRN family |
Subcellular Location | Cell membrane ; Lipid-anchor, GPI-anchor . |
Tissue Specificity | Almost exclusively expressed in brain, with weak expression in lung and stomach |
Identical and Related Proteins
Unique RefSeq proteins for LMP013613 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
73661200 | RefSeq | NP_001027015 | 147 | shadow of prion protein precursor |
Identical Sequences to LMP013613 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:73661200 | GenBank | EDM11908.1 | 147 | rCG47959, isoform CRA_b [Rattus norvegicus] |
GI:73661200 | RefSeq | XP_006230635.1 | 147 | PREDICTED: shadow of prion protein isoform X1 [Rattus norvegicus] |
GI:73661200 | SwissProt | Q5BIV7.1 | 147 | RecName: Full=Shadow of prion protein; Short=Protein shadoo; Flags: Precursor [Rattus norvegicus] |
GI:73661200 | tpe | CAG34290.1 | 147 | TPA: shadow precursor [Rattus norvegicus] |
Related Sequences to LMP013613 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:73661200 | GenBank | EDM11908.1 | 147 | rCG47959, isoform CRA_b [Rattus norvegicus] |
GI:73661200 | RefSeq | XP_006230635.1 | 147 | PREDICTED: shadow of prion protein isoform X1 [Rattus norvegicus] |
GI:73661200 | SwissProt | Q5BIV7.1 | 147 | RecName: Full=Shadow of prion protein; Short=Protein shadoo; Flags: Precursor [Rattus norvegicus] |
GI:73661200 | tpe | CAG34290.1 | 147 | TPA: shadow precursor [Rattus norvegicus] |