Gene/Proteome Database (LMPD)

LMPD ID
LMP013613
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
shadow of prion protein homolog (zebrafish)
Gene Symbol
Alternate Names
shadow of prion protein; Shadoo; protein shadoo;
Chromosome
1
Map Location
1q41

Proteins

shadow of prion protein precursor
Refseq ID NP_001027015
Protein GI 73661200
UniProt ID Q5BIV7
mRNA ID NM_001031845
Length 147
MNWTTATCWALLLATAFLCDSCSAKGGRGGARGSARGVRGGARGASRVRVRPAPRYSSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSGSGSVHSPRICLLLSGTLGALELLRP
sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2594 peptide sequence: MNWTTATCWALLLATAFLCDSCSA mat_peptide: 25..122 product: shadow of prion protein calculated_mol_wt: 9563 peptide sequence: KGGRGGARGSARGVRGGARGASRVRVRPAPRYSSSLRVAAAGAAAGAAAGVAAGLATGSGWRRTSGPGELGLEDDENGAMGGNGTDRGVYSYWAWTSG

Gene Information

Entrez Gene ID
Gene Name
shadow of prion protein homolog (zebrafish)
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 IEA:UniProtKB-KW C anchored component of membrane
GO:0005829 IEA:Ensembl C cytosol
GO:0005730 IEA:Ensembl C nucleolus
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0031982 IEA:Ensembl C vesicle
GO:0003676 IEA:Ensembl F nucleic acid binding
GO:0006606 IEA:Ensembl P protein import into nucleus

Domain Information

InterPro Annotations

Accession Description
IPR029238 Shadoo

UniProt Annotations

Entry Information

Gene Name
shadow of prion protein homolog (zebrafish)
Protein Entry
SPRN_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Prion-like protein that has PrP(C)-like neuroprotective activity. May act as a modulator for the biological actions of normal and abnormal PrP (By similarity)
Ptm N-glycosylated
Similarity Belongs to the SPRN family
Subcellular Location Cell membrane ; Lipid-anchor, GPI-anchor .
Tissue Specificity Almost exclusively expressed in brain, with weak expression in lung and stomach

Identical and Related Proteins

Unique RefSeq proteins for LMP013613 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
73661200 RefSeq NP_001027015 147 shadow of prion protein precursor

Identical Sequences to LMP013613 proteins

Reference Database Accession Length Protein Name
GI:73661200 GenBank EDM11908.1 147 rCG47959, isoform CRA_b [Rattus norvegicus]
GI:73661200 RefSeq XP_006230635.1 147 PREDICTED: shadow of prion protein isoform X1 [Rattus norvegicus]
GI:73661200 SwissProt Q5BIV7.1 147 RecName: Full=Shadow of prion protein; Short=Protein shadoo; Flags: Precursor [Rattus norvegicus]
GI:73661200 tpe CAG34290.1 147 TPA: shadow precursor [Rattus norvegicus]

Related Sequences to LMP013613 proteins

Reference Database Accession Length Protein Name
GI:73661200 GenBank EDM11908.1 147 rCG47959, isoform CRA_b [Rattus norvegicus]
GI:73661200 RefSeq XP_006230635.1 147 PREDICTED: shadow of prion protein isoform X1 [Rattus norvegicus]
GI:73661200 SwissProt Q5BIV7.1 147 RecName: Full=Shadow of prion protein; Short=Protein shadoo; Flags: Precursor [Rattus norvegicus]
GI:73661200 tpe CAG34290.1 147 TPA: shadow precursor [Rattus norvegicus]