Gene/Proteome Database (LMPD)
LMPD ID
LMP013623
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
apolipoprotein C-IV
Gene Symbol
Synonyms
Acl;
Alternate Names
apolipoprotein C-IV; ECL; apo-CIV; apoC-IV; apolipoprotein C4; apolipoprotein CIV; apolipoprotein E-linked; apolipoprotein C2 linked;
Chromosome
1
Map Location
1q21
Summary
member of the apolipoprotein family; gene is closely linked to the apolipoprotein E gene [RGD, Feb 2006]
Orthologs
Proteins
apolipoprotein C-IV precursor | |
---|---|
Refseq ID | NP_001102889 |
Protein GI | 157821489 |
UniProt ID | P55797 |
mRNA ID | NM_001109419 |
Length | 124 |
MSLLRCRQQTLPSLCLSVLFLACFVASMPTESLTPTPGPENSRWSLVRARVMEMVEPLVTRTRDRWRWFWGPRAIQGFVQTYYEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCRDWTQG | |
sig_peptide: 1..27 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3001 peptide sequence: MSLLRCRQQTLPSLCLSVLFLACFVAS mat_peptide: 28..124 product: Apolipoprotein C-IV experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P55797.2) calculated_mol_wt: 11549 peptide sequence: MPTESLTPTPGPENSRWSLVRARVMEMVEPLVTRTRDRWRWFWGPRAIQGFVQTYYEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCRDWTQG |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0034364 | IEA:Ensembl | C | high-density lipoprotein particle |
GO:0034361 | IEA:Ensembl | C | very-low-density lipoprotein particle |
GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
GO:0010890 | IEA:Ensembl | P | positive regulation of sequestering of triglyceride |
GO:0070328 | IEA:Ensembl | P | triglyceride homeostasis |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR028120 | Apolipoprotein C-IV |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P55797-1; Sequence=Displayed; Note=No experimental confirmation available.; Name=2; IsoId=P55797-2; Sequence=VSP_022002; Note=No experimental confirmation available.; |
Function | May participate in lipoprotein metabolism. |
Sequence Caution | Sequence=CAA39653.1; Type=Erroneous translation; Note=Wrong choice of frame.; Evidence= ; |
Similarity | Belongs to the apolipoprotein C4 family |
Subcellular Location | Secreted. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013623 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157821489 | RefSeq | NP_001102889 | 124 | apolipoprotein C-IV precursor |
Identical Sequences to LMP013623 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157821489 | GenBank | EDM08173.1 | 124 | rCG54131 [Rattus norvegicus] |
GI:157821489 | SwissProt | P55797.2 | 124 | RecName: Full=Apolipoprotein C-IV; Short=Apo-CIV; Short=ApoC-IV; AltName: Full=Apolipoprotein C4; AltName: Full=Apolipoprotein E-linked; AltName: Full=ECL; Flags: Precursor [Rattus norvegicus] |
Related Sequences to LMP013623 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157821489 | GenBank | AAH24657.1 | 124 | Apolipoprotein C-IV [Mus musculus] |
GI:157821489 | GenBank | EDM08173.1 | 124 | rCG54131 [Rattus norvegicus] |
GI:157821489 | RefSeq | NP_031411.1 | 124 | apolipoprotein C-IV precursor [Mus musculus] |
GI:157821489 | SwissProt | P55797.2 | 124 | RecName: Full=Apolipoprotein C-IV; Short=Apo-CIV; Short=ApoC-IV; AltName: Full=Apolipoprotein C4; AltName: Full=Apolipoprotein E-linked; AltName: Full=ECL; Flags: Precursor [Rattus norvegicus] |