Gene/Proteome Database (LMPD)
Proteins
myelin P2 protein | |
---|---|
Refseq ID | NP_001102984 |
Protein GI | 157816903 |
UniProt ID | D3ZFG5 |
mRNA ID | NM_001109514 |
Length | 132 |
MSNKFLGTWKLVSSEHFDDYMKALGVGLANRKLGNLAKPSVIISKKGDYITIRTESAFKNTEISFKLGQEFDETTADNRKTKSIVTLERGSLKQVQKWDGKETTIKRKLLDGKMVVECIMKGVVCTRIYEKV |
Gene Information
Entrez Gene ID
Gene Name
peripheral myelin protein 2
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0015485 | IEA:Ensembl | F | cholesterol binding |
GO:0005504 | IEA:Ensembl | F | fatty acid binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
GO:0061024 | IEA:Ensembl | P | membrane organization |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013639 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
157816903 | RefSeq | NP_001102984 | 132 | myelin P2 protein |
Identical Sequences to LMP013639 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157816903 | GenBank | EDM00996.1 | 132 | rCG41300 [Rattus norvegicus] |
Related Sequences to LMP013639 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:157816903 | GenBank | AAB19249.2 | 132 | myelin P2 [Mus sp.] |
GI:157816903 | GenBank | AAH99520.1 | 132 | Peripheral myelin protein 2 [Mus musculus] |
GI:157816903 | GenBank | EDM00996.1 | 132 | rCG41300 [Rattus norvegicus] |
GI:157816903 | RefSeq | XP_006977940.1 | 132 | PREDICTED: myelin P2 protein [Peromyscus maniculatus bairdii] |