Gene/Proteome Database (LMPD)
LMPD ID
LMP013640
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Z
Gene Symbol
Synonyms
Ncbp2;
Alternate Names
nuclear cap-binding protein subunit 2; CBP20; NCBP 20 kDa subunit; 20 kDa nuclear cap-binding protein;
Chromosome
11
Map Location
11q22
Proteins
| nuclear cap-binding protein subunit 2 | |
|---|---|
| Refseq ID | NP_001102995 |
| Protein GI | 157817217 |
| UniProt ID | B1WC40 |
| mRNA ID | NM_001109525 |
| Length | 156 |
| MSGGLLKALRSDSYVELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYREDYDAGRGGYGKLAQKQ | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Z
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0005846 | IEA:InterPro | C | nuclear cap binding complex |
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0000340 | ISS:UniProtKB | F | RNA 7-methylguanosine cap binding |
| GO:0000166 | IEA:InterPro | F | nucleotide binding |
| GO:0006370 | IEA:UniProtKB-KW | P | 7-methylguanosine mRNA capping |
| GO:0008380 | ISS:UniProtKB | P | RNA splicing |
| GO:0031047 | IEA:UniProtKB-KW | P | gene silencing by RNA |
| GO:0045292 | ISS:UniProtKB | P | mRNA cis splicing, via spliceosome |
| GO:0051028 | IEA:UniProtKB-KW | P | mRNA transport |
| GO:0000184 | IEA:UniProtKB-KW | P | nuclear-transcribed mRNA catabolic process, nonsense-mediated decay |
| GO:0046833 | ISS:UniProtKB | P | positive regulation of RNA export from nucleus |
| GO:0006417 | IEA:UniProtKB-KW | P | regulation of translation |
| GO:0006408 | ISS:UniProtKB | P | snRNA export from nucleus |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00399 | Cap binding complex |
| ko03013 | RNA transport |
| rno03013 | RNA transport |
| ko03040 | Spliceosome |
| rno03040 | Spliceosome |
| ko03015 | mRNA surveillance pathway |
| rno03015 | mRNA surveillance pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5953337 | Cleavage of Growing Transcript in the Termination Region |
| 5953620 | Formation of RNA Pol II elongation complex |
| 5953622 | Formation of the Early Elongation Complex |
| 5953330 | Gene Expression |
| 5953927 | Metabolism of non-coding RNA |
| 5954376 | Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC) |
| 5954374 | Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC) |
| 5954375 | Nonsense-Mediated Decay (NMD) |
| 5953331 | Processing of Capped Intron-Containing Pre-mRNA |
| 5953505 | Processing of Capped Intronless Pre-mRNA |
| 5953509 | Processing of Intronless Pre-mRNAs |
| 5953377 | RNA Polymerase II Pre-transcription Events |
| 5953339 | RNA Polymerase II Transcription |
| 5953621 | RNA Polymerase II Transcription Elongation |
| 5953338 | RNA Polymerase II Transcription Termination |
| 5953504 | SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs |
| 5953594 | SLBP independent Processing of Histone Pre-mRNAs |
| 5953449 | Transport of Mature Transcript to Cytoplasm |
| 5953510 | Transport of Mature mRNA Derived from an Intronless Transcript |
| 5953448 | Transport of Mature mRNA derived from an Intron-Containing Transcript |
| 5953508 | Transport of Mature mRNAs Derived from Intronless Transcripts |
| 5953507 | Transport of the SLBP Dependant Mature mRNA |
| 5953595 | Transport of the SLBP independent Mature mRNA |
| 5953334 | mRNA 3'-end processing |
| 5953494 | mRNA Capping |
| 5953333 | mRNA Splicing |
| 5953332 | mRNA Splicing - Major Pathway |
| 5953443 | mRNA Splicing - Minor Pathway |
| 5953926 | snRNP Assembly |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Z
Protein Entry
NCBP2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Function | Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing, translation regulation, nonsense-mediated mRNA decay, RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs) and mRNA export. The CBC complex is involved in mRNA export from the nucleus via its interaction with ALYREF/THOC4/ALY, leading to the recruitment of the mRNA export machinery to the 5' end of mRNA and to mRNA export in a 5' to 3' direction through the nuclear pore. The CBC complex is also involved in mediating U snRNA and intronless mRNAs export from the nucleus. The CBC complex is essential for a pioneer round of mRNA translation, before steady state translation when the CBC complex is replaced by cytoplasmic cap-binding protein eIF4E. The pioneer round of mRNA translation mediated by the CBC complex plays a central role in nonsense-mediated mRNA decay (NMD), NMD only taking place in mRNAs bound to the CBC complex, but not on eIF4E-bound mRNAs. The CBC complex enhances NMD in mRNAs containing at least one exon-junction complex (EJC) via its interaction with UPF1, promoting the interaction between UPF1 and UPF2. The CBC complex is also involved in 'failsafe' NMD, which is independent of the EJC complex, while it does not participate in Staufen-mediated mRNA decay (SMD). During cell proliferation, the CBC complex is also involved in microRNAs (miRNAs) biogenesis via its interaction with SRRT/ARS2, thereby being required for miRNA- mediated RNA interference. The CBC complex also acts as a negative regulator of PARN, thereby acting as an inhibitor of mRNA deadenylation. In the CBC complex, NCBP2/CBP20 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires NCBP1/CBP80 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure (By similarity) |
| Similarity | Belongs to the RRM NCBP2 family |
| Similarity | Contains 1 RRM (RNA recognition motif) domain |
| Subcellular Location | Nucleus . Cytoplasm . |
| Subunit | Component of the nuclear cap-binding complex (CBC), a heterodimer composed of NCBP1/CBP80 and NCBP2/CBP20 that interacts with m7GpppG-capped RNA. Found in a U snRNA export complex with RNUXA/PHAX, NCBP1/CBP80, NCBP2/CBP20, RAN, XPO1 and m7G-capped RNA. Interacts with RNUXA/PHAX, EIF4G1, HNRNPF, HNRNPH1 and ALYREF/THOC4/ALY (By similarity) |
Identical and Related Proteins
Unique RefSeq proteins for LMP013640 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157817217 | RefSeq | NP_001102995 | 156 | nuclear cap-binding protein subunit 2 |
Identical Sequences to LMP013640 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157817217 | GenBank | ERE76039.1 | 156 | nuclear cap-binding protein subunit 2-like protein [Cricetulus griseus] |
| GI:157817217 | RefSeq | XP_005344886.1 | 156 | PREDICTED: nuclear cap-binding protein subunit 2 isoform X2 [Microtus ochrogaster] |
| GI:157817217 | RefSeq | XP_007635688.1 | 156 | PREDICTED: nuclear cap-binding protein subunit 2 [Cricetulus griseus] |
| GI:157817217 | RefSeq | XP_008836729.1 | 156 | PREDICTED: nuclear cap-binding protein subunit 2 isoform X1 [Nannospalax galili] |
Related Sequences to LMP013640 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157817217 | DBBJ | BAB28389.1 | 156 | unnamed protein product [Mus musculus] |
| GI:157817217 | DBBJ | BAE27620.1 | 156 | unnamed protein product [Mus musculus] |
| GI:157817217 | RefSeq | NP_080830.1 | 156 | nuclear cap-binding protein subunit 2 [Mus musculus] |
| GI:157817217 | SwissProt | B1WC40.1 | 156 | RecName: Full=Nuclear cap-binding protein subunit 2; AltName: Full=20 kDa nuclear cap-binding protein; AltName: Full=NCBP 20 kDa subunit; Short=CBP20 [Rattus norvegicus] |