Gene/Proteome Database (LMPD)
Proteins
17-beta-hydroxysteroid dehydrogenase 14 | |
---|---|
Refseq ID | NP_001178040 |
Protein GI | 300798077 |
UniProt ID | D4A4Y2 |
mRNA ID | NM_001191111 |
Length | 270 |
MAAVGRYSGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDEAGGRAVEQELLGTVFIPGDVTQEGDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEENLLGAYTLIKLALPHLRKSKGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRYGVRVNCISPGNIWTPLWQELAAATSDPRATILEGTLAQPLGRMGQPAEVGAAAVFLASEATFCTGLELFMTGGAELGYGRKASSSTLVEVPILPP |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 14
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0004303 | IEA:Ensembl | F | estradiol 17-beta-dehydrogenase activity |
GO:0047045 | IEA:Ensembl | F | testosterone 17-beta-dehydrogenase (NADP+) activity |
GO:0006706 | IEA:Ensembl | P | steroid catabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 14
Protein Entry
D4A4Y2_RAT
UniProt ID
Species
Rat
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
Identical and Related Proteins
Unique RefSeq proteins for LMP013644 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
300798077 | RefSeq | NP_001178040 | 270 | 17-beta-hydroxysteroid dehydrogenase 14 |
Identical Sequences to LMP013644 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP013644 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:300798077 | RefSeq | NP_079606.3 | 273 | dehydrogenase/reductase (SDR family) member 10 [Mus musculus] |
GI:300798077 | RefSeq | XP_005366846.1 | 270 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase 14 [Microtus ochrogaster] |
GI:300798077 | RefSeq | XP_006982020.1 | 270 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase 14 [Peromyscus maniculatus bairdii] |
GI:300798077 | RefSeq | XP_007636890.1 | 270 | PREDICTED: 17-beta-hydroxysteroid dehydrogenase 14 isoform X2 [Cricetulus griseus] |