Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_002802920 |
Protein GI | 297286140 |
UniProt ID | F6SR59 |
mRNA ID | XM_001088834 |
Length | 356 |
MTAVLKDVNLRPEELGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPIALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPSEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN |
Refseq ID | XP_001088834 |
Protein GI | 297286138 |
UniProt ID | F6SR59 |
mRNA ID | XM_001088834 |
Length | 454 |
MWFCACADGCLLTPAVSSATGGWFVELSCAMQRLQVVLGHLTGRPDSGWMPQAAPCLSGAPQASAADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEELGDICVGNVLQPGAGAIMARIAQFLSDIPETVPLSTVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPIALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPSEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN |
Gene Information
Entrez Gene ID
Gene Name
acetyl-CoA acyltransferase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016020 | IEA:Ensembl | C | membrane |
GO:0005777 | IEA:Ensembl | C | peroxisome |
GO:0016401 | IEA:Ensembl | F | palmitoyl-CoA oxidase activity |
GO:0016747 | IEA:InterPro | F | transferase activity, transferring acyl groups other than amino-acyl groups |
GO:0008206 | IEA:Ensembl | P | bile acid metabolic process |
GO:0006635 | IEA:Ensembl | P | fatty acid beta-oxidation |
GO:0000038 | IEA:Ensembl | P | very long-chain fatty acid metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00592 | alpha-Linolenic acid metabolism |
mcc00592 | alpha-Linolenic acid metabolism |
M00087 | beta-Oxidation |
mcc_M00087 | beta-Oxidation |
ko01040 | Biosynthesis of unsaturated fatty acids |
mcc01040 | Biosynthesis of unsaturated fatty acids |
ko00071 | Fatty acid degradation |
mcc00071 | Fatty acid degradation |
ko01212 | Fatty acid metabolism |
mcc01212 | Fatty acid metabolism |
mcc01100 | Metabolic pathways |
ko04146 | Peroxisome |
mcc04146 | Peroxisome |
ko03320 | PPAR signaling pathway |
mcc03320 | PPAR signaling pathway |
ko00280 | Valine, leucine and isoleucine degradation |
mcc00280 | Valine, leucine and isoleucine degradation |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Gene Name
acetyl-CoA acyltransferase 1
Protein Entry
F6SR59_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Belongs to the thiolase family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013681 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
297286138 | RefSeq | XP_001088834 | 454 | acetyl-CoA acyltransferase 1 |
297286140 | RefSeq | XP_002802920 | 356 | acetyl-CoA acyltransferase 1 |
Identical Sequences to LMP013681 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP013681 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:297286140 | DBBJ | BAE72965.1 | 424 | hypothetical protein [Macaca fascicularis] |
GI:297286140 | GenBank | EHH16508.1 | 454 | hypothetical protein EGK_11796 [Macaca mulatta] |
GI:297286140 | GenBank | AFE77986.1 | 424 | 3-ketoacyl-CoA thiolase, peroxisomal isoform a [Macaca mulatta] |
GI:297286140 | GenBank | AFH32148.1 | 424 | 3-ketoacyl-CoA thiolase, peroxisomal isoform a [Macaca mulatta] |