Gene/Proteome Database (LMPD)
Proteins
alkaline ceramidase 3 | |
---|---|
Refseq ID | NP_001253680 |
Protein GI | 388490074 |
UniProt ID | F7EYF2 |
mRNA ID | NM_001266751 |
Length | 267 |
Protein sequence is identical to GI:109108005 (mRNA isoform) |
Refseq ID | XP_001088478 |
Protein GI | 109108005 |
UniProt ID | F7EYF2 |
mRNA ID | XM_001088478 |
Length | 267 |
MAPAADREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPVFGAIQSIRDGLEKRYIASYLALTVVGMGSWCFHMTLKYEMQLLDELPMIYSCCIFVYCMFECFKIKNSVNYHLLFTLVLFSLIVTTVYLKVKEPIFHQVMYGMLVFTLVLRSIYIVTWVYPWLRGLGYTSLGIFLLGFLFWNIDNIFCDSLRNFRKKVPPIIGITTQFHAWWHILTGLGSYLHILFSLYTRTLYLRYRPKVKFIFGIWPVILFEPLRKH |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030173 | IEA:Ensembl | C | integral component of Golgi membrane |
GO:0030176 | IEA:Ensembl | C | integral component of endoplasmic reticulum membrane |
GO:0070774 | IEA:Ensembl | F | phytoceramidase activity |
GO:0006672 | IEA:InterPro | P | ceramide metabolic process |
GO:0071602 | IEA:Ensembl | P | phytosphingosine biosynthetic process |
GO:0008284 | IEA:Ensembl | P | positive regulation of cell proliferation |
GO:0046512 | IEA:Ensembl | P | sphingosine biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR008901 | Ceramidase |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013698 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109108005 | RefSeq | XP_001088478 | 267 | alkaline ceramidase 3 |
Identical Sequences to LMP013698 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388490074 | GenBank | AFE66195.1 | 267 | alkaline ceramidase 3 [Macaca mulatta] |
GI:388490074 | RefSeq | XP_005579207.1 | 267 | PREDICTED: alkaline ceramidase 3 [Macaca fascicularis] |
Related Sequences to LMP013698 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388490074 | RefSeq | XP_008018411.1 | 267 | PREDICTED: alkaline ceramidase 3 isoform X1 [Chlorocebus sabaeus] |
GI:388490074 | RefSeq | XP_010365072.1 | 267 | PREDICTED: alkaline ceramidase 3 [Rhinopithecus roxellana] |