Gene/Proteome Database (LMPD)
Proteins
aldose reductase | |
---|---|
Refseq ID | NP_001252790 |
Protein GI | 388453765 |
UniProt ID | G7MME8 |
mRNA ID | NM_001265861 |
Length | 316 |
Protein sequence is identical to GI:109068261 (mRNA isoform) |
Refseq ID | XP_001100679 |
Protein GI | 109068261 |
UniProt ID | G7MME8 |
mRNA ID | XM_001100679 |
Length | 316 |
MASHLVLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEAILNKPGLKYKPAVNQIECHPYLTQEKLIQYCHSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSNQDMTTLLSYNRNWRVCALLSCASHKDYPFHEEF |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member B1 (aldose reductase)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016491 | IEA:InterPro | F | oxidoreductase activity |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00051 | Fructose and mannose metabolism |
mcc00051 | Fructose and mannose metabolism |
ko00052 | Galactose metabolism |
mcc00052 | Galactose metabolism |
ko00561 | Glycerolipid metabolism |
mcc00561 | Glycerolipid metabolism |
mcc01100 | Metabolic pathways |
ko00040 | Pentose and glucuronate interconversions |
mcc00040 | Pentose and glucuronate interconversions |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member B1 (aldose reductase)
Protein Entry
G7MME8_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013757 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109068261 | RefSeq | XP_001100679 | 316 | aldo-keto reductase family 1, member B1 (aldose reductase) |
Identical Sequences to LMP013757 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388453765 | GenBank | EHH17694.1 | 316 | hypothetical protein EGK_14153 [Macaca mulatta] |
GI:388453765 | GenBank | AFE77305.1 | 316 | aldose reductase [Macaca mulatta] |
GI:388453765 | GenBank | AFH31612.1 | 316 | aldose reductase [Macaca mulatta] |
GI:388453765 | GenBank | AFI36586.1 | 316 | aldose reductase [Macaca mulatta] |
Related Sequences to LMP013757 proteins
Reference | Database | Accession | Length | Protein Name |
---|