Gene/Proteome Database (LMPD)
LMPD ID
LMP013759
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4)
Gene Symbol
Synonyms
AKR1C2;
Alternate Names
aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III);
Chromosome
9
Map Location
chromosome:9
Proteins
| aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) | |
|---|---|
| Refseq ID | NP_001182504 |
| Protein GI | 307133780 |
| UniProt ID | F7HSY6 |
| mRNA ID | NM_001195575 |
| Length | 323 |
| Protein sequence is identical to GI:109088091 (mRNA isoform) | |
| Refseq ID | XP_002805588 |
| Protein GI | 297300413 |
| UniProt ID | F7HSY6 |
| mRNA ID | XM_001104300 |
| Length | 297 |
| MDSKHQRVKLNDGHFMPVLGFGTYAPVEVPKDKALEATKLAIEVGFRHVDCAYAYNNEEYVGLAIRSKIADGTVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHSPVSLKAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAFSALGSHREKQWVDQNSPVLLEDPVLCALAKKHKQTPALIALRYQLQRGVVVLAKSYTEQRIRENMKVFEFQLTSEDMKAIDGLDRNIRYLTLDILADSPNYPYSDEY | |
| Refseq ID | XP_001104300 |
| Protein GI | 109088091 |
| UniProt ID | F7HSY6 |
| mRNA ID | XM_001104300 |
| Length | 323 |
| MDSKHQRVKLNDGHFMPVLGFGTYAPVEVPKDKALEATKLAIEVGFRHVDCAYAYNNEEYVGLAIRSKIADGTVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHSPVSLKPGEELIPKDENGKVLFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAFSALGSHREKQWVDQNSPVLLEDPVLCALAKKHKQTPALIALRYQLQRGVVVLAKSYTEQRIRENMKVFEFQLTSEDMKAIDGLDRNIRYLTLDILADSPNYPYSDEY | |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016491 | IEA:InterPro | F | oxidoreductase activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4)
Protein Entry
F7HSY6_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013759 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109088091 | RefSeq | XP_001104300 | 323 | aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) |
| 297300413 | RefSeq | XP_002805588 | 297 | aldo-keto reductase family 1, member C4 (chlordecone reductase; 3-alpha hydroxysteroid dehydrogenase, type I; dihydrodiol dehydrogenase 4) |
Identical Sequences to LMP013759 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP013759 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:307133780 | GenBank | EHH64521.1 | 323 | Aldo-keto reductase family 1 member C1 [Macaca fascicularis] |
| GI:307133780 | RefSeq | XP_005564597.1 | 323 | PREDICTED: aldo-keto reductase family 1 member C1 homolog isoform X1 [Macaca fascicularis] |
| GI:307133780 | RefSeq | XP_008000323.1 | 323 | PREDICTED: aldo-keto reductase family 1 member C1 homolog isoform X2 [Chlorocebus sabaeus] |
| GI:307133780 | RefSeq | XP_008000326.1 | 323 | PREDICTED: aldo-keto reductase family 1 member C1 homolog isoform X4 [Chlorocebus sabaeus] |