Gene/Proteome Database (LMPD)

LMPD ID
LMP013760
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
Gene Symbol
Alternate Names
aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase);
Chromosome
3
Map Location
chromosome:3

Proteins

Refseq ID XP_001107157
Protein GI 109068373
UniProt ID F7GRQ0
mRNA ID XM_001107157
Length 326
MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEVYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVSNQVECHPYFTQPKLLKFCQQHDIVIIAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVPLLMWRDHPEYPFHDEY

Gene Information

Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016491 IEA:InterPro F oxidoreductase activity
GO:0008207 IEA:Ensembl P C21-steroid hormone metabolic process
GO:0008209 IEA:Ensembl P androgen metabolic process
GO:0006699 IEA:Ensembl P bile acid biosynthetic process
GO:0006707 IEA:Ensembl P cholesterol catabolic process
GO:0007586 IEA:Ensembl P digestion

KEGG Pathway Links

KEGG Pathway ID Description
mcc01100 Metabolic pathways
ko00120 Primary bile acid biosynthesis
mcc00120 Primary bile acid biosynthesis
ko00140 Steroid hormone biosynthesis
mcc00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)
Protein Entry
F7GRQ0_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013760 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109068373 RefSeq XP_001107157 326 aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase)

Identical Sequences to LMP013760 proteins

Reference Database Accession Length Protein Name
GI:109068373 GenBank EHH17715.1 326 hypothetical protein EGK_14176 [Macaca mulatta]
GI:109068373 GenBank EHH62035.1 326 hypothetical protein EGM_20209 [Macaca fascicularis]
GI:109068373 RefSeq XP_003896701.1 326 PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase [Papio anubis]
GI:109068373 RefSeq XP_005550938.1 326 PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Macaca fascicularis]

Related Sequences to LMP013760 proteins

Reference Database Accession Length Protein Name