Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001108171 |
Protein GI | 109065283 |
UniProt ID | F7F9E6 |
mRNA ID | XM_001108171 |
Length | 311 |
MACPKMRLMYICLLVLGALCWYFSMYNLNPFKEQSFTYKKEDRHFLKLPDTNCSQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHNDIIQKDFLDVYYNLTLKTMMGMEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTAYAFSGDVASQVYNVSNSVPYIKLEDVFVGLCLERLNIRLEELHSQQTFFPEGLRFSVCRFRRIVACHFVKPQALLDYWQALENSQKKDCPPV |
Gene Information
Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008378 | IEA:InterPro | F | galactosyltransferase activity |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00603 | Glycosphingolipid biosynthesis - globo series |
mcc00603 | Glycosphingolipid biosynthesis - globo series |
ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
mcc00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
M00070 | Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer |
mcc_M00070 | Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer |
mcc01100 | Metabolic pathways |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002659 | Glycosyl transferase, family 31 |
UniProt Annotations
Entry Information
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Protein Entry
F7F9E6_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013867 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109065283 | RefSeq | XP_001108171 | 311 | UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5 |
Identical Sequences to LMP013867 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109065283 | RefSeq | XP_005548716.1 | 311 | PREDICTED: beta-1,3-galactosyltransferase 5 isoform X2 [Macaca fascicularis] |
GI:109065283 | RefSeq | XP_005548717.1 | 311 | PREDICTED: beta-1,3-galactosyltransferase 5 isoform X3 [Macaca fascicularis] |
GI:109065283 | RefSeq | XP_005548718.1 | 311 | PREDICTED: beta-1,3-galactosyltransferase 5 isoform X4 [Macaca fascicularis] |
Related Sequences to LMP013867 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109065283 | RefSeq | XP_005548715.1 | 315 | PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Macaca fascicularis] |