Gene/Proteome Database (LMPD)

LMPD ID
LMP013867
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Alternate Names
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5;
Chromosome
3
Map Location
chromosome:3

Proteins

Refseq ID XP_001108171
Protein GI 109065283
UniProt ID F7F9E6
mRNA ID XM_001108171
Length 311
MACPKMRLMYICLLVLGALCWYFSMYNLNPFKEQSFTYKKEDRHFLKLPDTNCSQTPPFLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHNDIIQKDFLDVYYNLTLKTMMGMEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTAYAFSGDVASQVYNVSNSVPYIKLEDVFVGLCLERLNIRLEELHSQQTFFPEGLRFSVCRFRRIVACHFVKPQALLDYWQALENSQKKDCPPV

Gene Information

Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008378 IEA:InterPro F galactosyltransferase activity
GO:0006486 IEA:InterPro P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00603 Glycosphingolipid biosynthesis - globo series
mcc00603 Glycosphingolipid biosynthesis - globo series
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
mcc00601 Glycosphingolipid biosynthesis - lacto and neolacto series
M00070 Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
mcc_M00070 Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002659 Glycosyl transferase, family 31

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Protein Entry
F7F9E6_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013867 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109065283 RefSeq XP_001108171 311 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5

Identical Sequences to LMP013867 proteins

Reference Database Accession Length Protein Name
GI:109065283 RefSeq XP_005548716.1 311 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X2 [Macaca fascicularis]
GI:109065283 RefSeq XP_005548717.1 311 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X3 [Macaca fascicularis]
GI:109065283 RefSeq XP_005548718.1 311 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X4 [Macaca fascicularis]

Related Sequences to LMP013867 proteins

Reference Database Accession Length Protein Name
GI:109065283 RefSeq XP_005548715.1 315 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Macaca fascicularis]