Gene/Proteome Database (LMPD)

LMPD ID
LMP013929
Gene ID
574142
Species
Macaca mulatta (Rhesus monkey)
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
CNR1
Alternate Names
cannabinoid receptor 1; CB1; CB-R; cannabinoid receptor CB-1;
Chromosome
4
Map Location
chromosome:4

Proteins

cannabinoid receptor 1
Refseq ID NP_001027997
Protein GI 74136211
UniProt ID Q71SP5
mRNA ID NM_001032825
Length 472
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Gene Information

Entrez Gene ID
574142
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
CNR1
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0004949 ISS:UniProtKB F cannabinoid receptor activity
GO:0007188 ISS:UniProtKB P adenylate cyclase-modulating G-protein coupled receptor signaling pathway
GO:0038171 ISS:GOC P cannabinoid signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
ko04080 Neuroactive ligand-receptor interaction
mcc04080 Neuroactive ligand-receptor interaction
ko04015 Rap1 signaling pathway
mcc04015 Rap1 signaling pathway
ko04723 Retrograde endocannabinoid signaling
mcc04723 Retrograde endocannabinoid signaling

Domain Information

InterPro Annotations

Accession Description
IPR002230 Cannabinoid receptor family
IPR000810 Cannabinoid receptor type 1
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cannabinoid receptor 1 (brain)
Protein Entry
CNR1_MACMU
UniProt ID
Q71SP5
Species
Rhesus monkey

Comments

Comment Type Description
Function Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current (By similarity).
Ptm Palmitoylation at Cys-415 is important for recruitment at both plasma membrane and lipid rafts.
Similarity Belongs to the G-protein coupled receptor 1 family.
Subcellular Location Cell membrane ; Multi-pass membrane protein
Subunit Interacts (via C-terminus) with CNRIP1.

Identical and Related Proteins

Unique RefSeq proteins for LMP013929 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
74136211 RefSeq NP_001027997 472 cannabinoid receptor 1

Identical Sequences to LMP013929 proteins

Reference Database Accession Length Protein Name
GI:74136211 RefSeq XP_010360494.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:74136211 RefSeq XP_010360495.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:74136211 RefSeq XP_010360496.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:74136211 RefSeq XP_010360497.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]

Related Sequences to LMP013929 proteins

Reference Database Accession Length Protein Name
GI:74136211 EMBL CAA38699.1 472 cannabinoid receptor [Homo sapiens]
GI:74136211 GenBank AFE63879.1 472 cannabinoid receptor 1 isoform a [Macaca mulatta]
GI:74136211 RefSeq XP_005248707.1 472 PREDICTED: cannabinoid receptor 1 isoform X2 [Homo sapiens]
GI:74136211 SwissProt P21554.1 472 RecName: Full=Cannabinoid receptor 1; Short=CB-R; Short=CB1; AltName: Full=CANN6 [Homo sapiens]