Gene/Proteome Database (LMPD)

LMPD ID
LMP013977
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 18
Gene Symbol
Alternate Names
cytochrome P450 2C18;
Chromosome
9
Map Location
chromosome:9

Proteins

cytochrome P450 2C18 precursor
Refseq ID NP_001180995
Protein GI 302563907
UniProt ID E0V8I5
mRNA ID NM_001194066
Length 490
Protein sequence is identical to GI:109090033 (mRNA isoform)
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2723 peptide sequence: MDPAVALVLCLSCLFLLSLWRQSSG
Refseq ID XP_001097025
Protein GI 109090033
UniProt ID E0V8I5
mRNA ID XM_001097025
Length 490
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEKFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEALCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHNRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKVVKNFAYVKSYVLERIKEHQESLDMDNPRDFIDCFLIKMEQEKHNLQSEFTIESLIATVTDMFGAGTETTSTTLRFGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLIPTNLPHAVTCDVKFRNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDRSGNFKKSDYFMPFSAGKRMCVGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2723 peptide sequence: MDPAVALVLCLSCLFLLSLWRQSSG

Gene Information

Entrez Gene ID
Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 18
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 IEA:UniProtKB-KW F monooxygenase activity
GO:0016705 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen

KEGG Pathway Links

KEGG Pathway ID Description
ko05204 Chemical carcinogenesis
mcc05204 Chemical carcinogenesis
mcc01100 Metabolic pathways
ko00830 Retinol metabolism
mcc00830 Retinol metabolism
mcc04726 Serotonergic synapse

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 18
Protein Entry
E0V8I5_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP013977 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109090033 RefSeq XP_001097025 490 cytochrome P450, family 2, subfamily C, polypeptide 18

Identical Sequences to LMP013977 proteins

Reference Database Accession Length Protein Name
GI:302563907 GenBank ABB87190.1 490 cytochrome P450 2C18 [Macaca mulatta]

Related Sequences to LMP013977 proteins

Reference Database Accession Length Protein Name
GI:302563907 GenBank ABB87194.1 490 cytochrome P450 2C18 [Macaca fascicularis]
GI:302563907 RefSeq XP_005566051.1 490 PREDICTED: cytochrome P450 2C18-like isoform X1 [Macaca fascicularis]
GI:302563907 RefSeq XP_005566052.1 490 PREDICTED: cytochrome P450 2C18-like isoform X2 [Macaca fascicularis]