Gene/Proteome Database (LMPD)
Proteins
cytochrome P450 2C18 precursor | |
---|---|
Refseq ID | NP_001180995 |
Protein GI | 302563907 |
UniProt ID | E0V8I5 |
mRNA ID | NM_001194066 |
Length | 490 |
Protein sequence is identical to GI:109090033 (mRNA isoform) | |
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2723 peptide sequence: MDPAVALVLCLSCLFLLSLWRQSSG |
Refseq ID | XP_001097025 |
Protein GI | 109090033 |
UniProt ID | E0V8I5 |
mRNA ID | XM_001097025 |
Length | 490 |
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEKFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEALCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHNRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKVVKNFAYVKSYVLERIKEHQESLDMDNPRDFIDCFLIKMEQEKHNLQSEFTIESLIATVTDMFGAGTETTSTTLRFGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLIPTNLPHAVTCDVKFRNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDRSGNFKKSDYFMPFSAGKRMCVGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV | |
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2723 peptide sequence: MDPAVALVLCLSCLFLLSLWRQSSG |
Gene Information
Entrez Gene ID
Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 18
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0020037 | IEA:InterPro | F | heme binding |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0004497 | IEA:UniProtKB-KW | F | monooxygenase activity |
GO:0016705 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 18
Protein Entry
E0V8I5_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP013977 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109090033 | RefSeq | XP_001097025 | 490 | cytochrome P450, family 2, subfamily C, polypeptide 18 |
Identical Sequences to LMP013977 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:302563907 | GenBank | ABB87190.1 | 490 | cytochrome P450 2C18 [Macaca mulatta] |
Related Sequences to LMP013977 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:302563907 | GenBank | ABB87194.1 | 490 | cytochrome P450 2C18 [Macaca fascicularis] |
GI:302563907 | RefSeq | XP_005566051.1 | 490 | PREDICTED: cytochrome P450 2C18-like isoform X1 [Macaca fascicularis] |
GI:302563907 | RefSeq | XP_005566052.1 | 490 | PREDICTED: cytochrome P450 2C18-like isoform X2 [Macaca fascicularis] |