Gene/Proteome Database (LMPD)

LMPD ID
LMP013983
Gene ID
704242
Species
Macaca mulatta (Rhesus monkey)
Gene Name
cytochrome P450, family 39, subfamily A, polypeptide 1
Gene Symbol
CYP39A1
Alternate Names
24-hydroxycholesterol 7-alpha-hydroxylase;
Chromosome
4
Map Location
chromosome:4

Proteins

24-hydroxycholesterol 7-alpha-hydroxylase
Refseq ID NP_001181799
Protein GI 302564277
mRNA ID NM_001194870
Length 449
Protein sequence is identical to GI:297290977 (mRNA isoform)
Refseq ID XP_001102611
Protein GI 109071395
UniProt ID F6QGA0
mRNA ID XM_001102611
Length 469
MELIFPTVIIILGCLALFLLLQRKNLRRPPCIRGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYHTASIPKNVFLALHEKLYIMLKGKMGTVNLHQFTGQLTEELHEQLENLGTHGTMDLNNLVRHLLYPVTVNTLFNKSWFPTNKKKIKEFHQYFQAYDEDFEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAKDNSMTLLQATLDIVETETSKENSPNYGLLLLWASLSNAVPVAFWTLAYVLSHPDIHKAVMEGISSVFGTAGKDKIKVSEDDLEKLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIPSGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSFLDCFVAFGSGKFQCPGRWFALLEVQMCVILILYKYDCSLLDPLPKQSSLHLVGVPQPEGQCRIEYKQRI
Refseq ID XP_002803813
Protein GI 297290977
UniProt ID F6QGA0
mRNA ID XM_001102611
Length 449
MELIFPTVIIILGCLALFLLLQRKNLRRPPCIRGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYHTGKMGTVNLHQFTGQLTEELHEQLENLGTHGTMDLNNLVRHLLYPVTVNTLFNKSWFPTNKKKIKEFHQYFQAYDEDFEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAKDNSMTLLQATLDIVETETSKENSPNYGLLLLWASLSNAVPVAFWTLAYVLSHPDIHKAVMEGISSVFGTAGKDKIKVSEDDLEKLLLIKWCVLETIRLKAPGVITRKVVKPVEILNYIIPSGDLLMLSPFWLHRNPKYFPEPELFKPERWKKANLEKHSFLDCFVAFGSGKFQCPGRWFALLEVQMCVILILYKYDCSLLDPLPKQSSLHLVGVPQPEGQCRIEYKQRI

Gene Information

Entrez Gene ID
704242
Gene Name
cytochrome P450, family 39, subfamily A, polypeptide 1
Gene Symbol
CYP39A1
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IEA:UniProtKB-SubCell C endoplasmic reticulum membrane
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0008396 IEA:Ensembl F oxysterol 7-alpha-hydroxylase activity
GO:0008387 IEA:Ensembl F steroid 7-alpha-hydroxylase activity
GO:0006699 IEA:Ensembl P bile acid biosynthetic process
GO:0006707 IEA:Ensembl P cholesterol catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00120 Primary bile acid biosynthesis
mcc00120 Primary bile acid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002403 Cytochrome P450, E-class, group IV
IPR024204 Cytochrome P450, cholesterol 7-alpha-monooxygenase-type

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 39, subfamily A, polypeptide 1
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Cofactor Note=Heme group. {ECO:0000256|PIRNR:PIRNR000047, ECO:0000256|PIRSR:PIRSR000047-1};
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane

Identical and Related Proteins

Unique RefSeq proteins for LMP013983 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109071395 RefSeq XP_001102611 469 cytochrome P450, family 39, subfamily A, polypeptide 1
297290977 RefSeq XP_002803813 449 cytochrome P450, family 39, subfamily A, polypeptide 1

Identical Sequences to LMP013983 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP013983 proteins

Reference Database Accession Length Protein Name
GI:302564277 GenBank EHH53089.1 469 hypothetical protein EGM_13653 [Macaca fascicularis]
GI:302564277 RefSeq XP_003897739.1 449 PREDICTED: 24-hydroxycholesterol 7-alpha-hydroxylase isoform X6 [Papio anubis]
GI:302564277 RefSeq XP_005552869.1 449 PREDICTED: 24-hydroxycholesterol 7-alpha-hydroxylase-like isoform X2 [Macaca fascicularis]
GI:302564277 RefSeq XP_010354794.1 449 PREDICTED: 24-hydroxycholesterol 7-alpha-hydroxylase isoform X2 [Rhinopithecus roxellana]