Gene/Proteome Database (LMPD)
LMPD ID
LMP013996
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
dihydrolipoamide branched chain transacylase E2
Gene Symbol
Alternate Names
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial;
Chromosome
1
Map Location
chromosome:1
Proteins
| lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial | |
|---|---|
| Refseq ID | NP_001248206 |
| Protein GI | 386781934 |
| UniProt ID | F7C9Y3 |
| mRNA ID | NM_001261277 |
| Length | 482 |
| Protein sequence is identical to GI:109011473 (mRNA isoform) | |
| Refseq ID | XP_001107312 |
| Protein GI | 109011473 |
| UniProt ID | F7C9Y3 |
| mRNA ID | XM_001107312 |
| Length | 482 |
| MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKAEIMPPPPKPKDMTIPIPVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEVDLTELVKLREELKPIAFARGIKLSFMPFFLKAVSLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTYTKPVILPPEVAIGALGSIKAIPRFNQKGEVYKAQIVNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK | |
Gene Information
Entrez Gene ID
Gene Name
dihydrolipoamide branched chain transacylase E2
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0042645 | IEA:Ensembl | C | mitochondrial nucleoid |
| GO:0016746 | IEA:UniProtKB-KW | F | transferase activity, transferring acyl groups |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00036 | Leucine degradation, leucine => acetoacetate + acetyl-CoA |
| mcc_M00036 | Leucine degradation, leucine => acetoacetate + acetyl-CoA |
| mcc01100 | Metabolic pathways |
| ko00280 | Valine, leucine and isoleucine degradation |
| mcc00280 | Valine, leucine and isoleucine degradation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
| IPR001078 | 2-oxoacid dehydrogenase acyltransferase, catalytic domain |
| IPR000089 | Biotin/lipoyl attachment |
| IPR023213 | Chloramphenicol acetyltransferase-like domain |
| IPR004167 | E3-binding domain |
| IPR015761 | Lipoamide Acyltransferase |
| IPR011053 | Single hybrid motif |
UniProt Annotations
Entry Information
Gene Name
dihydrolipoamide branched chain transacylase E2
Protein Entry
F7C9Y3_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the 2-oxoacid dehydrogenase family. |
| Similarity | Contains 1 lipoyl-binding domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP013996 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109011473 | RefSeq | XP_001107312 | 482 | dihydrolipoamide branched chain transacylase E2 |
Identical Sequences to LMP013996 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781934 | GenBank | EHH14986.1 | 482 | hypothetical protein EGK_01009 [Macaca mulatta] |
| GI:386781934 | GenBank | EHH50104.1 | 482 | hypothetical protein EGM_00874 [Macaca fascicularis] |
| GI:386781934 | GenBank | AFH29293.1 | 482 | lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial precursor [Macaca mulatta] |
Related Sequences to LMP013996 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781934 | RefSeq | XP_005542663.1 | 527 | PREDICTED: lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial isoform X5 [Macaca fascicularis] |