Gene/Proteome Database (LMPD)

LMPD ID
LMP014000
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
delta(4)-desaturase, sphingolipid 1
Gene Symbol
Alternate Names
sphingolipid delta(4)-desaturase DES1; degenerative spermatocyte homolog 1, lipid desaturase;
Chromosome
1
Map Location
chromosome:1

Proteins

sphingolipid delta(4)-desaturase DES1
Refseq ID NP_001252935
Protein GI 388452770
UniProt ID F6PPX9
mRNA ID NM_001266006
Length 323
Protein sequence is identical to GI:109018131 (mRNA isoform)
Refseq ID XP_001096845
Protein GI 109018131
UniProt ID F6PPX9
mRNA ID XM_001096845
Length 323
MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMFLTQLAAFYIVKDLDWKWVIFGAYVFGSCINHSMTLAIHEISHNAAFGNCKAMWNRWFGMFANLPIGVPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTTFRKFIWVILQPLFYAFRPLFINPKPITYLEVINIVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLFTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

Gene Information

Entrez Gene ID
Gene Name
delta(4)-desaturase, sphingolipid 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:InterPro C integral component of membrane
GO:0016705 IEA:InterPro F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0030148 IEA:InterPro P sphingolipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00094 Ceramide biosynthesis
mcc_M00094 Ceramide biosynthesis
mcc01100 Metabolic pathways
ko00600 Sphingolipid metabolism
mcc00600 Sphingolipid metabolism
M00099 Sphingosine biosynthesis
mcc_M00099 Sphingosine biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR005804 Fatty acid desaturase, type 1
IPR011388 Sphingolipid delta4-desaturase
IPR013866 Sphingolipid delta4-desaturase, N-terminal

UniProt Annotations

Entry Information

Gene Name
delta(4)-desaturase, sphingolipid 1
Protein Entry
F6PPX9_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014000 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109018131 RefSeq XP_001096845 323 delta(4)-desaturase, sphingolipid 1

Identical Sequences to LMP014000 proteins

Reference Database Accession Length Protein Name
GI:388452770 GenBank AFE76004.1 323 sphingolipid delta(4)-desaturase DES1 [Macaca mulatta]
GI:388452770 GenBank AFH27893.1 323 sphingolipid delta(4)-desaturase DES1 [Macaca mulatta]
GI:388452770 GenBank AFI35873.1 323 sphingolipid delta(4)-desaturase DES1 [Macaca mulatta]
GI:388452770 RefSeq XP_005541003.1 323 PREDICTED: sphingolipid delta(4)-desaturase DES1 [Macaca fascicularis]

Related Sequences to LMP014000 proteins

Reference Database Accession Length Protein Name
GI:388452770 GenBank AFE66524.1 323 sphingolipid delta(4)-desaturase DES1 [Macaca mulatta]
GI:388452770 GenBank AFE75996.1 323 sphingolipid delta(4)-desaturase DES1 [Macaca mulatta]
GI:388452770 GenBank AFE75997.1 323 sphingolipid delta(4)-desaturase DES1 [Macaca mulatta]