Gene/Proteome Database (LMPD)
Proteins
| sphingolipid delta(4)-desaturase DES1 | |
|---|---|
| Refseq ID | NP_001252935 |
| Protein GI | 388452770 |
| UniProt ID | F6PPX9 |
| mRNA ID | NM_001266006 |
| Length | 323 |
| Protein sequence is identical to GI:109018131 (mRNA isoform) | |
| Refseq ID | XP_001096845 |
| Protein GI | 109018131 |
| UniProt ID | F6PPX9 |
| mRNA ID | XM_001096845 |
| Length | 323 |
| MGSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMFLTQLAAFYIVKDLDWKWVIFGAYVFGSCINHSMTLAIHEISHNAAFGNCKAMWNRWFGMFANLPIGVPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTTFRKFIWVILQPLFYAFRPLFINPKPITYLEVINIVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLFTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE | |
Gene Information
Entrez Gene ID
Gene Name
delta(4)-desaturase, sphingolipid 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0016705 | IEA:InterPro | F | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen |
| GO:0030148 | IEA:InterPro | P | sphingolipid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00094 | Ceramide biosynthesis |
| mcc_M00094 | Ceramide biosynthesis |
| mcc01100 | Metabolic pathways |
| ko00600 | Sphingolipid metabolism |
| mcc00600 | Sphingolipid metabolism |
| M00099 | Sphingosine biosynthesis |
| mcc_M00099 | Sphingosine biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta(4)-desaturase, sphingolipid 1
Protein Entry
F6PPX9_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014000 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109018131 | RefSeq | XP_001096845 | 323 | delta(4)-desaturase, sphingolipid 1 |
Identical Sequences to LMP014000 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388452770 | GenBank | AFE76004.1 | 323 | sphingolipid delta(4)-desaturase DES1 [Macaca mulatta] |
| GI:388452770 | GenBank | AFH27893.1 | 323 | sphingolipid delta(4)-desaturase DES1 [Macaca mulatta] |
| GI:388452770 | GenBank | AFI35873.1 | 323 | sphingolipid delta(4)-desaturase DES1 [Macaca mulatta] |
| GI:388452770 | RefSeq | XP_005541003.1 | 323 | PREDICTED: sphingolipid delta(4)-desaturase DES1 [Macaca fascicularis] |
Related Sequences to LMP014000 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388452770 | GenBank | AFE66524.1 | 323 | sphingolipid delta(4)-desaturase DES1 [Macaca mulatta] |
| GI:388452770 | GenBank | AFE75996.1 | 323 | sphingolipid delta(4)-desaturase DES1 [Macaca mulatta] |
| GI:388452770 | GenBank | AFE75997.1 | 323 | sphingolipid delta(4)-desaturase DES1 [Macaca mulatta] |