Gene/Proteome Database (LMPD)

LMPD ID
LMP014002
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
diacylglycerol O-acyltransferase 1
Gene Symbol
Alternate Names
diacylglycerol O-acyltransferase 1; diacylglycerol O-acyltransferase homolog 1;
Chromosome
8
Map Location
chromosome:8

Proteins

Refseq ID XP_001090134
Protein GI 109087724
UniProt ID F6Q252
mRNA ID XM_001090134
Length 491
MGDRGGAGGSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDMGAAGDAPAPVPSKDADDGVASGHWELRCHRLQDSLFSSDSGFNNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMVHTILFLKLFSYRDVNLWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCMNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSRWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLTLIIGQPIAVLMYVHDYYVLNYEAPVAGA

Gene Information

Entrez Gene ID
Gene Name
diacylglycerol O-acyltransferase 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IEA:UniProtKB-SubCell C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003846 IEA:Ensembl F 2-acylglycerol O-acyltransferase activity
GO:0004144 IEA:Ensembl F diacylglycerol O-acyltransferase activity
GO:0046339 IEA:Ensembl P diacylglycerol metabolic process
GO:0055089 IEA:Ensembl P fatty acid homeostasis
GO:0019915 IEA:Ensembl P lipid storage
GO:0035336 IEA:Ensembl P long-chain fatty-acyl-CoA metabolic process
GO:0019432 IEA:Ensembl P triglyceride biosynthetic process
GO:0034379 IEA:Ensembl P very-low-density lipoprotein particle assembly

KEGG Pathway Links

KEGG Pathway ID Description
ko04975 Fat digestion and absorption
mcc04975 Fat digestion and absorption
ko00561 Glycerolipid metabolism
mcc00561 Glycerolipid metabolism
mcc01100 Metabolic pathways
ko00830 Retinol metabolism
mcc00830 Retinol metabolism
M00089 Triacylglycerol biosynthesis
mcc_M00089 Triacylglycerol biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR027251 Diacylglycerol O-acyltransferase 1
IPR004299 Membrane bound O-acyl transferase, MBOAT
IPR014371 Sterol O-acyltransferase, ACAT/DAG/ARE types

UniProt Annotations

Entry Information

Gene Name
diacylglycerol O-acyltransferase 1
Protein Entry
F6Q252_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein

Identical and Related Proteins

Unique RefSeq proteins for LMP014002 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109087724 RefSeq XP_001090134 491 diacylglycerol O-acyltransferase 1

Identical Sequences to LMP014002 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014002 proteins

Reference Database Accession Length Protein Name
GI:109087724 GenBank AAF98557.1 491 diacyl-glycerol acyltransferase [Chlorocebus aethiops]
GI:109087724 RefSeq XP_005564399.1 491 PREDICTED: diacylglycerol O-acyltransferase 1 isoform X1 [Macaca fascicularis]
GI:109087724 RefSeq XP_005564400.1 485 PREDICTED: diacylglycerol O-acyltransferase 1 isoform X2 [Macaca fascicularis]
GI:109087724 SwissProt Q9GMF1.1 491 RecName: Full=Diacylglycerol O-acyltransferase 1; AltName: Full=Acyl-CoA retinol O-fatty-acyltransferase; Short=ARAT; Short=Retinol O-fatty-acyltransferase; AltName: Full=Diglyceride acyltransferase [Chlorocebus aethiops]