Gene/Proteome Database (LMPD)
Proteins
| Refseq ID | XP_001090134 |
| Protein GI | 109087724 |
| UniProt ID | F6Q252 |
| mRNA ID | XM_001090134 |
| Length | 491 |
| MGDRGGAGGSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDMGAAGDAPAPVPSKDADDGVASGHWELRCHRLQDSLFSSDSGFNNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMVHTILFLKLFSYRDVNLWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCMNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSRWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLTLIIGQPIAVLMYVHDYYVLNYEAPVAGA | |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol O-acyltransferase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IEA:UniProtKB-SubCell | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003846 | IEA:Ensembl | F | 2-acylglycerol O-acyltransferase activity |
| GO:0004144 | IEA:Ensembl | F | diacylglycerol O-acyltransferase activity |
| GO:0046339 | IEA:Ensembl | P | diacylglycerol metabolic process |
| GO:0055089 | IEA:Ensembl | P | fatty acid homeostasis |
| GO:0019915 | IEA:Ensembl | P | lipid storage |
| GO:0035336 | IEA:Ensembl | P | long-chain fatty-acyl-CoA metabolic process |
| GO:0019432 | IEA:Ensembl | P | triglyceride biosynthetic process |
| GO:0034379 | IEA:Ensembl | P | very-low-density lipoprotein particle assembly |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04975 | Fat digestion and absorption |
| mcc04975 | Fat digestion and absorption |
| ko00561 | Glycerolipid metabolism |
| mcc00561 | Glycerolipid metabolism |
| mcc01100 | Metabolic pathways |
| ko00830 | Retinol metabolism |
| mcc00830 | Retinol metabolism |
| M00089 | Triacylglycerol biosynthesis |
| mcc_M00089 | Triacylglycerol biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
diacylglycerol O-acyltransferase 1
Protein Entry
F6Q252_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Similarity | Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein |
Identical and Related Proteins
Unique RefSeq proteins for LMP014002 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109087724 | RefSeq | XP_001090134 | 491 | diacylglycerol O-acyltransferase 1 |
Identical Sequences to LMP014002 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP014002 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:109087724 | GenBank | AAF98557.1 | 491 | diacyl-glycerol acyltransferase [Chlorocebus aethiops] |
| GI:109087724 | RefSeq | XP_005564399.1 | 491 | PREDICTED: diacylglycerol O-acyltransferase 1 isoform X1 [Macaca fascicularis] |
| GI:109087724 | RefSeq | XP_005564400.1 | 485 | PREDICTED: diacylglycerol O-acyltransferase 1 isoform X2 [Macaca fascicularis] |
| GI:109087724 | SwissProt | Q9GMF1.1 | 491 | RecName: Full=Diacylglycerol O-acyltransferase 1; AltName: Full=Acyl-CoA retinol O-fatty-acyltransferase; Short=ARAT; Short=Retinol O-fatty-acyltransferase; AltName: Full=Diglyceride acyltransferase [Chlorocebus aethiops] |