Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001090134 |
Protein GI | 109087724 |
UniProt ID | F6Q252 |
mRNA ID | XM_001090134 |
Length | 491 |
MGDRGGAGGSRRRRTGSRPSSHGGGGPAAAEEEVRDAAAGPDMGAAGDAPAPVPSKDADDGVASGHWELRCHRLQDSLFSSDSGFNNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSLFLKDPYSWPAPCLVIAANVFAVAAFQVEKRLAVGALTEQAGLLLHVANLATILCFPAAVVLLVESITPVGSLLALMVHTILFLKLFSYRDVNLWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCMNAVAELMQFGDREFYRDWWNSESVTYFWQNWNIPVHKWCIRHFYKPMLRRGSSRWMARTGVFLASAFFHEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQGNYGNAAVWLTLIIGQPIAVLMYVHDYYVLNYEAPVAGA |
Gene Information
Entrez Gene ID
Gene Name
diacylglycerol O-acyltransferase 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | IEA:UniProtKB-SubCell | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0003846 | IEA:Ensembl | F | 2-acylglycerol O-acyltransferase activity |
GO:0004144 | IEA:Ensembl | F | diacylglycerol O-acyltransferase activity |
GO:0046339 | IEA:Ensembl | P | diacylglycerol metabolic process |
GO:0055089 | IEA:Ensembl | P | fatty acid homeostasis |
GO:0019915 | IEA:Ensembl | P | lipid storage |
GO:0035336 | IEA:Ensembl | P | long-chain fatty-acyl-CoA metabolic process |
GO:0019432 | IEA:Ensembl | P | triglyceride biosynthetic process |
GO:0034379 | IEA:Ensembl | P | very-low-density lipoprotein particle assembly |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04975 | Fat digestion and absorption |
mcc04975 | Fat digestion and absorption |
ko00561 | Glycerolipid metabolism |
mcc00561 | Glycerolipid metabolism |
mcc01100 | Metabolic pathways |
ko00830 | Retinol metabolism |
mcc00830 | Retinol metabolism |
M00089 | Triacylglycerol biosynthesis |
mcc_M00089 | Triacylglycerol biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
diacylglycerol O-acyltransferase 1
Protein Entry
F6Q252_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily. |
Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein |
Identical and Related Proteins
Unique RefSeq proteins for LMP014002 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109087724 | RefSeq | XP_001090134 | 491 | diacylglycerol O-acyltransferase 1 |
Identical Sequences to LMP014002 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014002 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109087724 | GenBank | AAF98557.1 | 491 | diacyl-glycerol acyltransferase [Chlorocebus aethiops] |
GI:109087724 | RefSeq | XP_005564399.1 | 491 | PREDICTED: diacylglycerol O-acyltransferase 1 isoform X1 [Macaca fascicularis] |
GI:109087724 | RefSeq | XP_005564400.1 | 485 | PREDICTED: diacylglycerol O-acyltransferase 1 isoform X2 [Macaca fascicularis] |
GI:109087724 | SwissProt | Q9GMF1.1 | 491 | RecName: Full=Diacylglycerol O-acyltransferase 1; AltName: Full=Acyl-CoA retinol O-fatty-acyltransferase; Short=ARAT; Short=Retinol O-fatty-acyltransferase; AltName: Full=Diglyceride acyltransferase [Chlorocebus aethiops] |