Gene/Proteome Database (LMPD)
LMPD ID
LMP014023
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Symbol
Alternate Names
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial;
Chromosome
7
Map Location
chromosome:7
Proteins
| dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial | |
|---|---|
| Refseq ID | NP_001247678 |
| Protein GI | 386781828 |
| UniProt ID | F6YNF6 |
| mRNA ID | NM_001260749 |
| Length | 454 |
| Protein sequence is identical to GI:109084326 (mRNA isoform) | |
| Refseq ID | XP_001095138 |
| Protein GI | 109084326 |
| UniProt ID | F6YNF6 |
| mRNA ID | XM_001095138 |
| Length | 454 |
| MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAVPVPPPAAPIPTQMPPVPSPSQPSSSKPVSAVKPTAAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNYADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL | |
Gene Information
Entrez Gene ID
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016020 | IEA:Ensembl | C | membrane |
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0045252 | IEA:InterPro | C | oxoglutarate dehydrogenase complex |
| GO:0004149 | IEA:InterPro | F | dihydrolipoyllysine-residue succinyltransferase activity |
| GO:0006099 | IEA:InterPro | P | tricarboxylic acid cycle |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko01200 | Carbon metabolism |
| mcc01200 | Carbon metabolism |
| M00011 | Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate |
| mcc_M00011 | Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate |
| ko00020 | Citrate cycle (TCA cycle) |
| mcc00020 | Citrate cycle (TCA cycle) |
| M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
| mcc_M00009 | Citrate cycle (TCA cycle, Krebs cycle) |
| ko00310 | Lysine degradation |
| mcc00310 | Lysine degradation |
| M00032 | Lysine degradation, lysine => saccharopine => acetoacetyl-CoA |
| mcc_M00032 | Lysine degradation, lysine => saccharopine => acetoacetyl-CoA |
| mcc01100 | Metabolic pathways |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001078 | 2-oxoacid dehydrogenase acyltransferase, catalytic domain |
| IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
| IPR000089 | Biotin/lipoyl attachment |
| IPR023213 | Chloramphenicol acetyltransferase-like domain |
| IPR006255 | Dihydrolipoamide succinyltransferase |
| IPR011053 | Single hybrid motif |
UniProt Annotations
Entry Information
Gene Name
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Protein Entry
F6YNF6_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the 2-oxoacid dehydrogenase family. |
| Similarity | Contains 1 lipoyl-binding domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014023 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109084326 | RefSeq | XP_001095138 | 454 | dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) |
Identical Sequences to LMP014023 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781828 | GenBank | AFH31351.1 | 454 | dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial [Macaca mulatta] |
| GI:386781828 | GenBank | AFH31352.1 | 454 | dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial [Macaca mulatta] |
| GI:386781828 | GenBank | AFJ71335.1 | 454 | dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial [Macaca mulatta] |
| GI:386781828 | RefSeq | XP_005561839.1 | 454 | PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial [Macaca fascicularis] |
Related Sequences to LMP014023 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781828 | GenBank | EHH28048.1 | 454 | hypothetical protein EGK_18384 [Macaca mulatta] |
| GI:386781828 | GenBank | EHH62308.1 | 454 | hypothetical protein EGM_20611 [Macaca fascicularis] |