Gene/Proteome Database (LMPD)

LMPD ID
LMP014033
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 3
Gene Symbol
Alternate Names
dolichyl-phosphate mannosyltransferase polypeptide 3;
Chromosome
1
Map Location
chromosome:1

Proteins

Refseq ID XP_001115270
Protein GI 109017165
UniProt ID F6R3K4
mRNA ID XM_001115270
Length 92
MTKLAQWLWGLAILGSTWAALTTGAMGLELPLSCQEVLWPLPAYLLVSAGCYALATVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF
Refseq ID XP_001115254
Protein GI 109017167
UniProt ID F6R3K4
mRNA ID XM_001115270
Length 92
Protein sequence is identical to GI:109017165 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 3
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0033185 IEA:Ensembl C dolichol-phosphate-mannose synthase complex
GO:0030176 IEA:Ensembl C integral component of endoplasmic reticulum membrane
GO:0004582 IEA:Ensembl F dolichyl-phosphate beta-D-mannosyltransferase activity
GO:0006506 IEA:Ensembl P GPI anchor biosynthetic process
GO:0031647 IEA:Ensembl P regulation of protein stability

KEGG Pathway Links

KEGG Pathway ID Description
mcc01100 Metabolic pathways
ko00510 N-Glycan biosynthesis
mcc00510 N-Glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR013174 Dolichol-phosphate mannosyltransferase subunit 3

UniProt Annotations

Entry Information

Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 3
Protein Entry
F6R3K4_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014033 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109017165 RefSeq XP_001115270 92 dolichyl-phosphate mannosyltransferase polypeptide 3

Identical Sequences to LMP014033 proteins

Reference Database Accession Length Protein Name
GI:109017165 GenBank EHH15309.1 92 hypothetical protein EGK_01378 [Macaca mulatta]
GI:109017165 GenBank EHH50344.1 92 hypothetical protein EGM_01157 [Macaca fascicularis]
GI:109017165 RefSeq XP_005541659.1 92 PREDICTED: dolichol-phosphate mannosyltransferase subunit 3 isoform X1 [Macaca fascicularis]
GI:109017165 RefSeq XP_005541660.1 92 PREDICTED: dolichol-phosphate mannosyltransferase subunit 3 isoform X2 [Macaca fascicularis]

Related Sequences to LMP014033 proteins

Reference Database Accession Length Protein Name