Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001115270 |
Protein GI | 109017165 |
UniProt ID | F6R3K4 |
mRNA ID | XM_001115270 |
Length | 92 |
MTKLAQWLWGLAILGSTWAALTTGAMGLELPLSCQEVLWPLPAYLLVSAGCYALATVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF |
Refseq ID | XP_001115254 |
Protein GI | 109017167 |
UniProt ID | F6R3K4 |
mRNA ID | XM_001115270 |
Length | 92 |
Protein sequence is identical to GI:109017165 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 3
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0033185 | IEA:Ensembl | C | dolichol-phosphate-mannose synthase complex |
GO:0030176 | IEA:Ensembl | C | integral component of endoplasmic reticulum membrane |
GO:0004582 | IEA:Ensembl | F | dolichyl-phosphate beta-D-mannosyltransferase activity |
GO:0006506 | IEA:Ensembl | P | GPI anchor biosynthetic process |
GO:0031647 | IEA:Ensembl | P | regulation of protein stability |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR013174 | Dolichol-phosphate mannosyltransferase subunit 3 |
UniProt Annotations
Entry Information
Gene Name
dolichyl-phosphate mannosyltransferase polypeptide 3
Protein Entry
F6R3K4_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014033 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109017165 | RefSeq | XP_001115270 | 92 | dolichyl-phosphate mannosyltransferase polypeptide 3 |
Identical Sequences to LMP014033 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109017165 | GenBank | EHH15309.1 | 92 | hypothetical protein EGK_01378 [Macaca mulatta] |
GI:109017165 | GenBank | EHH50344.1 | 92 | hypothetical protein EGM_01157 [Macaca fascicularis] |
GI:109017165 | RefSeq | XP_005541659.1 | 92 | PREDICTED: dolichol-phosphate mannosyltransferase subunit 3 isoform X1 [Macaca fascicularis] |
GI:109017165 | RefSeq | XP_005541660.1 | 92 | PREDICTED: dolichol-phosphate mannosyltransferase subunit 3 isoform X2 [Macaca fascicularis] |
Related Sequences to LMP014033 proteins
Reference | Database | Accession | Length | Protein Name |
---|