Gene/Proteome Database (LMPD)

LMPD ID
LMP014043
Gene ID
704135
Species
Macaca mulatta (Rhesus monkey)
Gene Name
endothelin receptor type A
Gene Symbol
EDNRA
Alternate Names
endothelin-1 receptor;
Chromosome
5
Map Location
chromosome:5

Proteins

endothelin-1 receptor precursor
Refseq ID NP_001248421
Protein GI 387762883
UniProt ID F7HSF3
mRNA ID NM_001261492
Length 427
Protein sequence is identical to GI:109075838 (mRNA isoform)
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2199 peptide sequence: METVCLRASFWLALVGCVIS
Refseq ID XP_001098827
Protein GI 109075838
UniProt ID F7HSF3
mRNA ID XM_001098827
Length 427
METVCLRASFWLALVGCVISDNAERYSTNLSNHVDDFTTFHGTELSLLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHEQNNHNTDRSSHKDSMN
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2199 peptide sequence: METVCLRASFWLALVGCVIS

Gene Information

Entrez Gene ID
704135
Gene Name
endothelin receptor type A
Gene Symbol
EDNRA
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004962 IEA:Ensembl F endothelin receptor activity
GO:0014824 IEA:Ensembl P artery smooth muscle contraction
GO:0048484 IEA:InterPro P enteric nervous system development
GO:0015758 IEA:Ensembl P glucose transport
GO:0060322 IEA:Ensembl P head development
GO:0007507 IEA:Ensembl P heart development
GO:0001701 IEA:Ensembl P in utero embryonic development
GO:0030818 IEA:Ensembl P negative regulation of cAMP biosynthetic process
GO:0014032 IEA:Ensembl P neural crest cell development
GO:0001569 IEA:Ensembl P patterning of blood vessels
GO:0008217 IEA:InterPro P regulation of blood pressure
GO:0007585 IEA:Ensembl P respiratory gaseous exchange
GO:0001666 IEA:Ensembl P response to hypoxia

KEGG Pathway Links

KEGG Pathway ID Description
ko04020 Calcium signaling pathway
mcc04020 Calcium signaling pathway
ko04080 Neuroactive ligand-receptor interaction
mcc04080 Neuroactive ligand-receptor interaction
ko04270 Vascular smooth muscle contraction
mcc04270 Vascular smooth muscle contraction
ko04024 cAMP signaling pathway
mcc04024 cAMP signaling pathway
ko04022 cGMP-PKG signaling pathway
mcc04022 cGMP-PKG signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR002175 Endothelin receptor A
IPR000499 Endothelin receptor family
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
endothelin receptor type A
Protein Entry
F7HSF3_MACMU
UniProt ID
F7HSF3
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014043 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109075838 RefSeq XP_001098827 427 endothelin receptor type A

Identical Sequences to LMP014043 proteins

Reference Database Accession Length Protein Name
GI:387762883 GenBank EHH26227.1 427 hypothetical protein EGK_16143 [Macaca mulatta]
GI:387762883 GenBank AFI34646.1 427 endothelin-1 receptor isoform a precursor [Macaca mulatta]
GI:387762883 GenBank AFJ71111.1 427 endothelin-1 receptor isoform a precursor [Macaca mulatta]

Related Sequences to LMP014043 proteins

Reference Database Accession Length Protein Name
GI:387762883 RefSeq XP_005556090.1 427 PREDICTED: endothelin-1 receptor isoform X1 [Macaca fascicularis]