Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001091337 |
Protein GI | 109069640 |
mRNA ID | XM_001091337 |
Length | 354 |
MQLLFSDASKLIICFGTYTFFGECCRPLRRDWETPERGFEQCESRPSWQYSSSHLNPVKEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVIYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFSAANGVMNKKAQ |
Gene Information
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Gene Name
ELOVL fatty acid elongase 2
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014051 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109069640 | RefSeq | XP_001091337 | 354 |
Identical Sequences to LMP014051 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014051 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109069640 | GenBank | EHH52710.1 | 295 | Elongation of very long chain fatty acids protein 2, partial [Macaca fascicularis] |
GI:109069640 | GenBank | AFE65773.1 | 296 | elongation of very long chain fatty acids protein 2 [Macaca mulatta] |
GI:109069640 | RefSeq | XP_002746274.1 | 334 | PREDICTED: elongation of very long chain fatty acids protein 2 isoform X2 [Callithrix jacchus] |
GI:109069640 | RefSeq | XP_010355464.1 | 377 | PREDICTED: elongation of very long chain fatty acids protein 2 [Rhinopithecus roxellana] |