Gene/Proteome Database (LMPD)

LMPD ID
LMP014053
Gene ID
692070
Species
Macaca mulatta (Rhesus monkey)
Gene Name
ELOVL fatty acid elongase 4
Gene Symbol
ELOVL4
Alternate Names
elongation of very long chain fatty acids protein 4; ELOVL FA elongase 4; 3-keto acyl-CoA synthase Elovl4; very-long-chain 3-oxoacyl-CoA synthase 4; elongation of very long chain fatty acids 4; elongation of very long chain fatty acids-like 4; elongation of very long chain fatty acids (FEN1/Elo2, SUR4/Elo3, yeast)-like 4;
Chromosome
4
Map Location
chromosome:4
EC Number
2.3.1.199

Proteins

elongation of very long chain fatty acids protein 4
Refseq ID NP_001035509
Protein GI 95147351
UniProt ID Q3S8M4
mRNA ID NM_001040419
Length 314
MGLLDSEPGSVLNVVSTALNDTVEFYRWTWSIADKRVENWPLMQSPWPTLSISTLYLLFVWLGPKWMKDREPFQMRLVLIIYNFGMVLLNFFIFRELFMGSYNAGYSYICQSVDYSNNVNEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYHHCTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLAAFGPWIQKYLWWKRYLTMLQLVQFHVTIGHTALSLYTDCPFPKWMHWALIAYAISFIFLFLNFYIRTYKEPKKPKTGKTAMNGISANGVSKSEKQLVIENGKKQKNGKAKGD

Gene Information

Entrez Gene ID
692070
Gene Name
ELOVL fatty acid elongase 4
Gene Symbol
ELOVL4
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0030176 ISS:UniProtKB C integral component of endoplasmic reticulum membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0019367 ISS:UniProtKB P fatty acid elongation, saturated fatty acid
GO:0042761 ISS:UniProtKB P very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00062 Fatty acid elongation
mcc00062 Fatty acid elongation

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 4
Protein Entry
ELOV4_MACMU
UniProt ID
Q3S8M4
Species
Rhesus monkey

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Domain The di-lysine motif may confer endoplasmic reticulum localization.
Function Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs). Seems to represent a photoreceptor-specific component of the fatty acid elongation system residing on the endoplasmic reticulum. May play a critical role in early brain and skin development.
Similarity Belongs to the ELO family.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein

Identical and Related Proteins

Unique RefSeq proteins for LMP014053 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
95147351 RefSeq NP_001035509 314 elongation of very long chain fatty acids protein 4

Identical Sequences to LMP014053 proteins

Reference Database Accession Length Protein Name
GI:95147351 GenBank AFE66399.1 314 elongation of very long chain fatty acids protein 4 [Macaca mulatta]
GI:95147351 GenBank AFH30031.1 314 elongation of very long chain fatty acids protein 4 [Macaca mulatta]
GI:95147351 RefSeq NP_001270132.1 314 elongation of very long chain fatty acids protein 4 [Macaca fascicularis]
GI:95147351 RefSeq XP_008004621.1 314 PREDICTED: elongation of very long chain fatty acids protein 4 [Chlorocebus sabaeus]

Related Sequences to LMP014053 proteins

Reference Database Accession Length Protein Name
GI:95147351 GenBank AAZ95094.1 314 elongation of very long chain fatty acids 4 protein [Macaca mulatta]