Gene/Proteome Database (LMPD)

LMPD ID
LMP014080
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
fatty acid binding protein 2, intestinal
Gene Symbol
Alternate Names
fatty acid binding protein 2, intestinal;
Chromosome
5
Map Location
chromosome:5

Proteins

Refseq ID XP_001099243
Protein GI 109075506
UniProt ID F7FGH2
mRNA ID XM_001099243
Length 132
MAFNGTWKVDRSENYDKFMEKMGVNLVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELSGTWSLEGNKLVGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 2, intestinal
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005622 IEA:Ensembl C intracellular
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0005215 IEA:InterPro F transporter activity

KEGG Pathway Links

KEGG Pathway ID Description
ko04975 Fat digestion and absorption
mcc04975 Fat digestion and absorption
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 2, intestinal
Protein Entry
F7FGH2_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014080 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109075506 RefSeq XP_001099243 132 fatty acid binding protein 2, intestinal

Identical Sequences to LMP014080 proteins

Reference Database Accession Length Protein Name
GI:109075506 GenBank EHH26151.1 132 hypothetical protein EGK_16050 [Macaca mulatta]
GI:109075506 GenBank EHH53934.1 132 hypothetical protein EGM_14649 [Macaca fascicularis]
GI:109075506 RefSeq XP_005555866.1 132 PREDICTED: fatty acid-binding protein, intestinal [Macaca fascicularis]

Related Sequences to LMP014080 proteins

Reference Database Accession Length Protein Name
GI:109075506 RefSeq XP_007997860.1 132 PREDICTED: fatty acid-binding protein, intestinal [Chlorocebus sabaeus]