Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001099243 |
Protein GI | 109075506 |
UniProt ID | F7FGH2 |
mRNA ID | XM_001099243 |
Length | 132 |
MAFNGTWKVDRSENYDKFMEKMGVNLVKRKLAAHDNLKLTITQEGNKFTVKESSTFRNIEVVFELGVTFNYNLADGTELSGTWSLEGNKLVGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKD |
Gene Information
Entrez Gene ID
Gene Name
fatty acid binding protein 2, intestinal
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005622 | IEA:Ensembl | C | intracellular |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
fatty acid binding protein 2, intestinal
Protein Entry
F7FGH2_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014080 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109075506 | RefSeq | XP_001099243 | 132 | fatty acid binding protein 2, intestinal |
Identical Sequences to LMP014080 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109075506 | GenBank | EHH26151.1 | 132 | hypothetical protein EGK_16050 [Macaca mulatta] |
GI:109075506 | GenBank | EHH53934.1 | 132 | hypothetical protein EGM_14649 [Macaca fascicularis] |
GI:109075506 | RefSeq | XP_005555866.1 | 132 | PREDICTED: fatty acid-binding protein, intestinal [Macaca fascicularis] |
Related Sequences to LMP014080 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109075506 | RefSeq | XP_007997860.1 | 132 | PREDICTED: fatty acid-binding protein, intestinal [Chlorocebus sabaeus] |