Gene/Proteome Database (LMPD)
Proteins
| alpha-(1,3)-fucosyltransferase | |
|---|---|
| Refseq ID | NP_001180994 |
| Protein GI | 302563897 |
| UniProt ID | F7HQD6 |
| mRNA ID | NM_001194065 |
| Length | 359 |
| Protein sequence is identical to GI:297291366 (mRNA isoform) | |
| Refseq ID | XP_001096830 |
| Protein GI | 297291366 |
| UniProt ID | F7HQD6 |
| mRNA ID | XM_001096830 |
| Length | 359 |
| MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN | |
Gene Information
Entrez Gene ID
Gene Name
fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0032580 | IEA:UniProtKB-SubCell | C | Golgi cisterna membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0046920 | IEA:Ensembl | F | alpha-(1->3)-fucosyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00603 | Glycosphingolipid biosynthesis - globo series |
| mcc00603 | Glycosphingolipid biosynthesis - globo series |
| ko00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| mcc00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| mcc01100 | Metabolic pathways |
| ko00514 | Other types of O-glycan biosynthesis |
| mcc00514 | Other types of O-glycan biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001503 | Glycosyl transferase, family 10 |
UniProt Annotations
Entry Information
Gene Name
fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
Protein Entry
F7HQD6_MACMU
UniProt ID
Species
Rhesus monkey
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the glycosyltransferase 10 family. |
| Subcellular Location | Golgi apparatus, Golgi stack membrane ; Single-pass type II membrane protein |
Identical and Related Proteins
Unique RefSeq proteins for LMP014120 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297291366 | RefSeq | XP_001096830 | 359 | fucosyltransferase 9 (alpha (1,3) fucosyltransferase) |
Identical Sequences to LMP014120 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302563897 | RefSeq | XP_009449941.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 isoform X1 [Pan troglodytes] |
| GI:302563897 | RefSeq | XP_009449942.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 isoform X1 [Pan troglodytes] |
| GI:302563897 | RefSeq | XP_010357520.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Rhinopithecus roxellana] |
| GI:302563897 | RefSeq | XP_010332077.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Saimiri boliviensis boliviensis] |
Related Sequences to LMP014120 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302563897 | GenBank | ELW54527.1 | 359 | Alpha-(1,3)-fucosyltransferase [Tupaia chinensis] |
| GI:302563897 | RefSeq | XP_008004842.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus] |
| GI:302563897 | RefSeq | XP_008004843.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus] |
| GI:302563897 | RefSeq | XP_008004844.1 | 359 | PREDICTED: alpha-(1,3)-fucosyltransferase 9 [Chlorocebus sabaeus] |