Gene/Proteome Database (LMPD)
LMPD ID
LMP014178
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
G protein-coupled estrogen receptor 1
Gene Symbol
Synonyms
GPER1; GPR30;
Alternate Names
G protein-coupled estrogen receptor 1; G protein-coupled receptor 30; G-protein coupled receptor 30; G-protein coupled estrogen receptor 1;
Chromosome
3
Map Location
chromosome:3
Proteins
Refseq ID | XP_001084531 |
Protein GI | 109065802 |
UniProt ID | F7EQ49 |
mRNA ID | XM_001084531 |
Length | 375 |
MEVTSQARGMGLEMYPGTMQPAAPNTTSPELNLSHPLLGASLANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHEQYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFREKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV |
Gene Information
Entrez Gene ID
Gene Name
G protein-coupled estrogen receptor 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0030424 | ISS:UniProtKB | C | axon |
GO:0043679 | ISS:UniProtKB | C | axon terminus |
GO:0030054 | IEA:UniProtKB-KW | C | cell junction |
GO:0005737 | ISS:UniProtKB | C | cytoplasm |
GO:0030659 | ISS:UniProtKB | C | cytoplasmic vesicle membrane |
GO:0030425 | ISS:UniProtKB | C | dendrite |
GO:0043198 | ISS:UniProtKB | C | dendritic shaft |
GO:0044327 | ISS:UniProtKB | C | dendritic spine head |
GO:0032591 | ISS:UniProtKB | C | dendritic spine membrane |
GO:0005769 | ISS:UniProtKB | C | early endosome |
GO:0005783 | ISS:UniProtKB | C | endoplasmic reticulum |
GO:0005794 | ISS:UniProtKB | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005622 | ISS:UniProtKB | C | intracellular |
GO:0045095 | ISS:UniProtKB | C | keratin filament |
GO:0031966 | ISS:UniProtKB | C | mitochondrial membrane |
GO:0097481 | ISS:UniProtKB | C | neuronal postsynaptic density |
GO:0005635 | ISS:UniProtKB | C | nuclear envelope |
GO:0005634 | ISS:UniProtKB | C | nucleus |
GO:0048471 | ISS:UniProtKB | C | perinuclear region of cytoplasm |
GO:0005886 | ISS:UniProtKB | C | plasma membrane |
GO:0014069 | ISS:UniProtKB | C | postsynaptic density |
GO:0045211 | IEA:UniProtKB-KW | C | postsynaptic membrane |
GO:0048786 | ISS:UniProtKB | C | presynaptic active zone |
GO:0042734 | ISS:UniProtKB | C | presynaptic membrane |
GO:0055037 | ISS:UniProtKB | C | recycling endosome |
GO:0005802 | ISS:UniProtKB | C | trans-Golgi network |
GO:0003682 | ISS:UniProtKB | F | chromatin binding |
GO:0030284 | ISS:UniProtKB | F | estrogen receptor activity |
GO:0004930 | IEA:UniProtKB-KW | F | G-protein coupled receptor activity |
GO:0017082 | ISS:UniProtKB | F | mineralocorticoid receptor activity |
GO:0005496 | ISS:UniProtKB | F | steroid binding |
GO:0030263 | ISS:UniProtKB | P | apoptotic chromosome condensation |
GO:0007049 | IEA:UniProtKB-KW | P | cell cycle |
GO:0071392 | IDA:UniProtKB | P | cellular response to estradiol stimulus |
GO:0071333 | ISS:UniProtKB | P | cellular response to glucose stimulus |
GO:0071389 | ISS:UniProtKB | P | cellular response to mineralocorticoid stimulus |
GO:0071375 | IEA:Ensembl | P | cellular response to peptide hormone stimulus |
GO:0071356 | IEA:Ensembl | P | cellular response to tumor necrosis factor |
GO:0051480 | IDA:UniProtKB | P | cytosolic calcium ion homeostasis |
GO:0006954 | IEA:UniProtKB-KW | P | inflammatory response |
GO:0045087 | IEA:UniProtKB-KW | P | innate immune response |
GO:0030518 | ISS:UniProtKB | P | intracellular steroid hormone receptor signaling pathway |
GO:0031959 | ISS:GOC | P | mineralocorticoid receptor signaling pathway |
GO:0071157 | ISS:UniProtKB | P | negative regulation of cell cycle arrest |
GO:0008285 | ISS:UniProtKB | P | negative regulation of cell proliferation |
GO:0051053 | ISS:UniProtKB | P | negative regulation of DNA metabolic process |
GO:0045599 | ISS:UniProtKB | P | negative regulation of fat cell differentiation |
GO:0010629 | ISS:UniProtKB | P | negative regulation of gene expression |
GO:0050728 | ISS:UniProtKB | P | negative regulation of inflammatory response |
GO:0002695 | ISS:UniProtKB | P | negative regulation of leukocyte activation |
GO:0051055 | ISS:UniProtKB | P | negative regulation of lipid biosynthetic process |
GO:0019228 | IDA:UniProtKB | P | neuronal action potential |
GO:0030264 | ISS:UniProtKB | P | nuclear fragmentation involved in apoptotic nuclear change |
GO:0010579 | ISS:UniProtKB | P | positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway |
GO:0043065 | ISS:UniProtKB | P | positive regulation of apoptotic process |
GO:0030819 | ISS:UniProtKB | P | positive regulation of cAMP biosynthetic process |
GO:0030335 | ISS:UniProtKB | P | positive regulation of cell migration |
GO:0008284 | ISS:UniProtKB | P | positive regulation of cell proliferation |
GO:0043280 | ISS:UniProtKB | P | positive regulation of cysteine-type endopeptidase activity involved in apoptotic process |
GO:0007204 | ISS:UniProtKB | P | positive regulation of cytosolic calcium ion concentration |
GO:2000353 | ISS:UniProtKB | P | positive regulation of endothelial cell apoptotic process |
GO:0045742 | ISS:UniProtKB | P | positive regulation of epidermal growth factor receptor signaling pathway |
GO:0070374 | ISS:UniProtKB | P | positive regulation of ERK1 and ERK2 cascade |
GO:0090004 | IEA:Ensembl | P | positive regulation of establishment of protein localization to plasma membrane |
GO:2001238 | ISS:UniProtKB | P | positive regulation of extrinsic apoptotic signaling pathway |
GO:0010628 | ISS:UniProtKB | P | positive regulation of gene expression |
GO:0045745 | IDA:UniProtKB | P | positive regulation of G-protein coupled receptor protein signaling pathway |
GO:0032962 | ISS:UniProtKB | P | positive regulation of inositol trisphosphate biosynthetic process |
GO:0032024 | ISS:UniProtKB | P | positive regulation of insulin secretion |
GO:0043410 | ISS:UniProtKB | P | positive regulation of MAPK cascade |
GO:0050769 | ISS:UniProtKB | P | positive regulation of neurogenesis |
GO:0001956 | IDA:UniProtKB | P | positive regulation of neurotransmitter secretion |
GO:0014068 | ISS:UniProtKB | P | positive regulation of phosphatidylinositol 3-kinase signaling |
GO:0001934 | ISS:UniProtKB | P | positive regulation of protein phosphorylation |
GO:0090200 | ISS:UniProtKB | P | positive regulation of release of cytochrome c from mitochondria |
GO:0051281 | ISS:UniProtKB | P | positive regulation of release of sequestered calcium ion into cytosol |
GO:0045944 | ISS:UniProtKB | P | positive regulation of transcription from RNA polymerase II promoter |
GO:0070474 | IEA:Ensembl | P | positive regulation of uterine smooth muscle contraction |
GO:0045909 | ISS:UniProtKB | P | positive regulation of vasodilation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
G protein-coupled estrogen receptor 1
Protein Entry
GPER1_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Function | G-protein coupled estrogen receptor that binds to 17- beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Stimulates cAMP production, calcium mobilization and tyrosine kinase Src inducing the release of heparin-bound epidermal growth factor (HB-EGF) and subsequent transactivation of the epidermal growth factor receptor (EGFR), activating downstream signaling pathways such as PI3K/Akt and ERK/MAPK. Mediates pleiotropic functions among others in the cardiovascular, endocrine, reproductive, immune and central nervous systems. Has a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a RAMP3-dependent manner. Regulates arterial blood pressure by stimulating vasodilation and reducing vascular smooth muscle and microvascular endothelial cell proliferation. Plays a role in blood glucose homeostasis contributing to the insulin secretion response by pancreatic beta cells. Triggers mitochondrial apoptosis during pachytene spermatocyte differentiation. Stimulates uterine epithelial cell proliferation. Enhances uterine contractility in response to oxytocin. Contributes to thymic atrophy by inducing apoptosis. Attenuates TNF-mediated endothelial expression of leukocyte adhesion molecules. Promotes neuritogenesis in developing hippocampal neurons. Plays a role in acute neuroprotection against NMDA- induced excitotoxic neuronal death. Inhibits early osteoblast proliferation at growth plate during skeletal development. Inhibits mature adipocyte differentiation and lipid accumulation. Involved in the recruitment of beta-arrestin 2 ARRB2 at the plasma membrane in epithelial cells. Functions also as a receptor for aldosterone mediating rapid regulation of vascular contractibility through the PI3K/ERK signaling pathway. Involved in cancer progression regulation. Stimulates cancer-associated fibroblast (CAF) proliferation by a rapid genomic response through the EGFR/ERK transduction pathway. Associated with EGFR, may act as a transcription factor activating growth regulatory genes (c-fos, cyclin D1). Promotes integrin alpha-5/beta-1 and fibronectin (FN) matrix assembly in breast cancer cells (By similarity). Increases firing activity and intracellular calcium oscillations in luteinizing hormone-releasing hormone (LHRH) neurons. |
Ptm | Glycosylated. |
Ptm | Ubiquitinated; ubiquitination occurs at the plasma membrane and leads to proteasome-mediated degradation. |
Similarity | Belongs to the G-protein coupled receptor 1 family. |
Subcellular Location | Nucleus Cytoplasm, perinuclear region {ECO:0000250}. Cytoplasm Cytoplasm, cytoskeleton Cytoplasmic vesicle membrane {ECO:0000250}; Multi-pass membrane protein Cell membrane ; Multi-pass membrane protein {ECO:0000250}. Basolateral cell membrane ; Multi-pass membrane protein Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein Early endosome {ECO:0000250}. Recycling endosome Golgi apparatus, trans-Golgi network Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein Cell projection, dendrite Cell projection, dendritic spine membrane ; Multi-pass membrane protein {ECO:0000250}. Cell projection, axon Cell junction, synapse, postsynaptic cell membrane, postsynaptic density {ECO:0000250}. Mitochondrion membrane ; Multi-pass membrane protein Note=Endocytosed in a agonist- and arrestin-independent manner. Colocalized with RAMP3 and clathrin-coated pits at the plasma membrane. Colocalized with transferrin receptor at the plasma membrane and perinuclear region. Accumulated and colocalized with RAB11 proteins in recycling endosomes and trans-Golgi network (TGN), but does neither recycle back to the cell surface nor traffics to late endosome or lysosome. Colocalized with calnexin in the endoplasmic reticulum. Traffics to intracellular sites via cytokeratin intermediate filaments like KRT7 and KRT8 after constitutive endocytosis in epithelial cells. Colocalized with EGFR in the nucleus of agonist-induced cancer-associated fibroblasts (CAF) (By similarity). Colocalized with BSN to the active zone of presynaptic density. Colocalized with DLG4/PSD95 and neurabin-2 PPP1R9B in neuronal synaptosomes (By similarity). |
Subunit | Homodimer. Heterodimer; heterodimerizes with other G- protein-coupled receptor (GPCRs) like CRHR1, HTR1A and PAQR8. Interacts with RAMP3. Interacts with KRT7 and KRT8. Interacts with EGFR; the interaction increases after agonist-induced stimulation in cancer-associated fibroblasts (CAF). Interacts with EGFR and ESR1. Interacts (via C-terminus tail motif) with DLG4 (via N- terminus tandem pair of PDZ domains); the interaction is direct and induces the increase of GPER1 protein levels residing at the plasma membrane surface in a estradiol-independent manner (By similarity). |
Tissue Specificity | Expressed in olfactory placode and LH- releasing hormone (LHRH) neurons (at protein level). Expressed in hypothalamus, cerebellum, olfactory placode and uterus. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014178 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109065802 | RefSeq | XP_001084531 | 375 | G protein-coupled estrogen receptor 1 |
Identical Sequences to LMP014178 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109065802 | GenBank | EHH17092.1 | 375 | hypothetical protein EGK_13399 [Macaca mulatta] |
GI:109065802 | GenBank | EHH51961.1 | 375 | hypothetical protein EGM_12306 [Macaca fascicularis] |
GI:109065802 | RefSeq | XP_005549035.1 | 375 | PREDICTED: G-protein coupled estrogen receptor 1 [Macaca fascicularis] |
GI:109065802 | SwissProt | F7EQ49.1 | 375 | RecName: Full=G-protein coupled estrogen receptor 1; AltName: Full=G protein-coupled estrogen receptor 1; AltName: Full=G-protein coupled receptor 30 [Macaca mulatta] |
Related Sequences to LMP014178 proteins
Reference | Database | Accession | Length | Protein Name |
---|