Gene/Proteome Database (LMPD)

LMPD ID
LMP014178
Gene ID
696625
Species
Macaca mulatta (Rhesus monkey)
Gene Name
G protein-coupled estrogen receptor 1
Gene Symbol
GPER
Synonyms
GPER1; GPR30;
Alternate Names
G protein-coupled estrogen receptor 1; G protein-coupled receptor 30; G-protein coupled receptor 30; G-protein coupled estrogen receptor 1;
Chromosome
3
Map Location
chromosome:3

Proteins

Refseq ID XP_001084531
Protein GI 109065802
UniProt ID F7EQ49
mRNA ID XM_001084531
Length 375
MEVTSQARGMGLEMYPGTMQPAAPNTTSPELNLSHPLLGASLANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHEQYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFREKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV

Gene Information

Entrez Gene ID
696625
Gene Name
G protein-coupled estrogen receptor 1
Gene Symbol
GPER
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030424 ISS:UniProtKB C axon
GO:0043679 ISS:UniProtKB C axon terminus
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0005737 ISS:UniProtKB C cytoplasm
GO:0030659 ISS:UniProtKB C cytoplasmic vesicle membrane
GO:0030425 ISS:UniProtKB C dendrite
GO:0043198 ISS:UniProtKB C dendritic shaft
GO:0044327 ISS:UniProtKB C dendritic spine head
GO:0032591 ISS:UniProtKB C dendritic spine membrane
GO:0005769 ISS:UniProtKB C early endosome
GO:0005783 ISS:UniProtKB C endoplasmic reticulum
GO:0005794 ISS:UniProtKB C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005622 ISS:UniProtKB C intracellular
GO:0045095 ISS:UniProtKB C keratin filament
GO:0031966 ISS:UniProtKB C mitochondrial membrane
GO:0097481 ISS:UniProtKB C neuronal postsynaptic density
GO:0005635 ISS:UniProtKB C nuclear envelope
GO:0005634 ISS:UniProtKB C nucleus
GO:0048471 ISS:UniProtKB C perinuclear region of cytoplasm
GO:0005886 ISS:UniProtKB C plasma membrane
GO:0014069 ISS:UniProtKB C postsynaptic density
GO:0045211 IEA:UniProtKB-KW C postsynaptic membrane
GO:0048786 ISS:UniProtKB C presynaptic active zone
GO:0042734 ISS:UniProtKB C presynaptic membrane
GO:0055037 ISS:UniProtKB C recycling endosome
GO:0005802 ISS:UniProtKB C trans-Golgi network
GO:0003682 ISS:UniProtKB F chromatin binding
GO:0030284 ISS:UniProtKB F estrogen receptor activity
GO:0004930 IEA:UniProtKB-KW F G-protein coupled receptor activity
GO:0017082 ISS:UniProtKB F mineralocorticoid receptor activity
GO:0005496 ISS:UniProtKB F steroid binding
GO:0030263 ISS:UniProtKB P apoptotic chromosome condensation
GO:0007049 IEA:UniProtKB-KW P cell cycle
GO:0071392 IDA:UniProtKB P cellular response to estradiol stimulus
GO:0071333 ISS:UniProtKB P cellular response to glucose stimulus
GO:0071389 ISS:UniProtKB P cellular response to mineralocorticoid stimulus
GO:0071375 IEA:Ensembl P cellular response to peptide hormone stimulus
GO:0071356 IEA:Ensembl P cellular response to tumor necrosis factor
GO:0051480 IDA:UniProtKB P cytosolic calcium ion homeostasis
GO:0006954 IEA:UniProtKB-KW P inflammatory response
GO:0045087 IEA:UniProtKB-KW P innate immune response
GO:0030518 ISS:UniProtKB P intracellular steroid hormone receptor signaling pathway
GO:0031959 ISS:GOC P mineralocorticoid receptor signaling pathway
GO:0071157 ISS:UniProtKB P negative regulation of cell cycle arrest
GO:0008285 ISS:UniProtKB P negative regulation of cell proliferation
GO:0051053 ISS:UniProtKB P negative regulation of DNA metabolic process
GO:0045599 ISS:UniProtKB P negative regulation of fat cell differentiation
GO:0010629 ISS:UniProtKB P negative regulation of gene expression
GO:0050728 ISS:UniProtKB P negative regulation of inflammatory response
GO:0002695 ISS:UniProtKB P negative regulation of leukocyte activation
GO:0051055 ISS:UniProtKB P negative regulation of lipid biosynthetic process
GO:0019228 IDA:UniProtKB P neuronal action potential
GO:0030264 ISS:UniProtKB P nuclear fragmentation involved in apoptotic nuclear change
GO:0010579 ISS:UniProtKB P positive regulation of adenylate cyclase activity involved in G-protein coupled receptor signaling pathway
GO:0043065 ISS:UniProtKB P positive regulation of apoptotic process
GO:0030819 ISS:UniProtKB P positive regulation of cAMP biosynthetic process
GO:0030335 ISS:UniProtKB P positive regulation of cell migration
GO:0008284 ISS:UniProtKB P positive regulation of cell proliferation
GO:0043280 ISS:UniProtKB P positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0007204 ISS:UniProtKB P positive regulation of cytosolic calcium ion concentration
GO:2000353 ISS:UniProtKB P positive regulation of endothelial cell apoptotic process
GO:0045742 ISS:UniProtKB P positive regulation of epidermal growth factor receptor signaling pathway
GO:0070374 ISS:UniProtKB P positive regulation of ERK1 and ERK2 cascade
GO:0090004 IEA:Ensembl P positive regulation of establishment of protein localization to plasma membrane
GO:2001238 ISS:UniProtKB P positive regulation of extrinsic apoptotic signaling pathway
GO:0010628 ISS:UniProtKB P positive regulation of gene expression
GO:0045745 IDA:UniProtKB P positive regulation of G-protein coupled receptor protein signaling pathway
GO:0032962 ISS:UniProtKB P positive regulation of inositol trisphosphate biosynthetic process
GO:0032024 ISS:UniProtKB P positive regulation of insulin secretion
GO:0043410 ISS:UniProtKB P positive regulation of MAPK cascade
GO:0050769 ISS:UniProtKB P positive regulation of neurogenesis
GO:0001956 IDA:UniProtKB P positive regulation of neurotransmitter secretion
GO:0014068 ISS:UniProtKB P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0001934 ISS:UniProtKB P positive regulation of protein phosphorylation
GO:0090200 ISS:UniProtKB P positive regulation of release of cytochrome c from mitochondria
GO:0051281 ISS:UniProtKB P positive regulation of release of sequestered calcium ion into cytosol
GO:0045944 ISS:UniProtKB P positive regulation of transcription from RNA polymerase II promoter
GO:0070474 IEA:Ensembl P positive regulation of uterine smooth muscle contraction
GO:0045909 ISS:UniProtKB P positive regulation of vasodilation

KEGG Pathway Links

KEGG Pathway ID Description
ko04915 Estrogen signaling pathway
mcc04915 Estrogen signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR017452 GPCR, rhodopsin-like, 7TM
IPR000276 G protein-coupled receptor, rhodopsin-like

UniProt Annotations

Entry Information

Gene Name
G protein-coupled estrogen receptor 1
Protein Entry
GPER1_MACMU
UniProt ID
F7EQ49
Species
Rhesus monkey

Comments

Comment Type Description
Function G-protein coupled estrogen receptor that binds to 17- beta-estradiol (E2) with high affinity, leading to rapid and transient activation of numerous intracellular signaling pathways. Stimulates cAMP production, calcium mobilization and tyrosine kinase Src inducing the release of heparin-bound epidermal growth factor (HB-EGF) and subsequent transactivation of the epidermal growth factor receptor (EGFR), activating downstream signaling pathways such as PI3K/Akt and ERK/MAPK. Mediates pleiotropic functions among others in the cardiovascular, endocrine, reproductive, immune and central nervous systems. Has a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a RAMP3-dependent manner. Regulates arterial blood pressure by stimulating vasodilation and reducing vascular smooth muscle and microvascular endothelial cell proliferation. Plays a role in blood glucose homeostasis contributing to the insulin secretion response by pancreatic beta cells. Triggers mitochondrial apoptosis during pachytene spermatocyte differentiation. Stimulates uterine epithelial cell proliferation. Enhances uterine contractility in response to oxytocin. Contributes to thymic atrophy by inducing apoptosis. Attenuates TNF-mediated endothelial expression of leukocyte adhesion molecules. Promotes neuritogenesis in developing hippocampal neurons. Plays a role in acute neuroprotection against NMDA- induced excitotoxic neuronal death. Inhibits early osteoblast proliferation at growth plate during skeletal development. Inhibits mature adipocyte differentiation and lipid accumulation. Involved in the recruitment of beta-arrestin 2 ARRB2 at the plasma membrane in epithelial cells. Functions also as a receptor for aldosterone mediating rapid regulation of vascular contractibility through the PI3K/ERK signaling pathway. Involved in cancer progression regulation. Stimulates cancer-associated fibroblast (CAF) proliferation by a rapid genomic response through the EGFR/ERK transduction pathway. Associated with EGFR, may act as a transcription factor activating growth regulatory genes (c-fos, cyclin D1). Promotes integrin alpha-5/beta-1 and fibronectin (FN) matrix assembly in breast cancer cells (By similarity). Increases firing activity and intracellular calcium oscillations in luteinizing hormone-releasing hormone (LHRH) neurons.
Ptm Glycosylated.
Ptm Ubiquitinated; ubiquitination occurs at the plasma membrane and leads to proteasome-mediated degradation.
Similarity Belongs to the G-protein coupled receptor 1 family.
Subcellular Location Nucleus Cytoplasm, perinuclear region {ECO:0000250}. Cytoplasm Cytoplasm, cytoskeleton Cytoplasmic vesicle membrane {ECO:0000250}; Multi-pass membrane protein Cell membrane ; Multi-pass membrane protein {ECO:0000250}. Basolateral cell membrane ; Multi-pass membrane protein Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein Early endosome {ECO:0000250}. Recycling endosome Golgi apparatus, trans-Golgi network Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein Cell projection, dendrite Cell projection, dendritic spine membrane ; Multi-pass membrane protein {ECO:0000250}. Cell projection, axon Cell junction, synapse, postsynaptic cell membrane, postsynaptic density {ECO:0000250}. Mitochondrion membrane ; Multi-pass membrane protein Note=Endocytosed in a agonist- and arrestin-independent manner. Colocalized with RAMP3 and clathrin-coated pits at the plasma membrane. Colocalized with transferrin receptor at the plasma membrane and perinuclear region. Accumulated and colocalized with RAB11 proteins in recycling endosomes and trans-Golgi network (TGN), but does neither recycle back to the cell surface nor traffics to late endosome or lysosome. Colocalized with calnexin in the endoplasmic reticulum. Traffics to intracellular sites via cytokeratin intermediate filaments like KRT7 and KRT8 after constitutive endocytosis in epithelial cells. Colocalized with EGFR in the nucleus of agonist-induced cancer-associated fibroblasts (CAF) (By similarity). Colocalized with BSN to the active zone of presynaptic density. Colocalized with DLG4/PSD95 and neurabin-2 PPP1R9B in neuronal synaptosomes (By similarity).
Subunit Homodimer. Heterodimer; heterodimerizes with other G- protein-coupled receptor (GPCRs) like CRHR1, HTR1A and PAQR8. Interacts with RAMP3. Interacts with KRT7 and KRT8. Interacts with EGFR; the interaction increases after agonist-induced stimulation in cancer-associated fibroblasts (CAF). Interacts with EGFR and ESR1. Interacts (via C-terminus tail motif) with DLG4 (via N- terminus tandem pair of PDZ domains); the interaction is direct and induces the increase of GPER1 protein levels residing at the plasma membrane surface in a estradiol-independent manner (By similarity).
Tissue Specificity Expressed in olfactory placode and LH- releasing hormone (LHRH) neurons (at protein level). Expressed in hypothalamus, cerebellum, olfactory placode and uterus.

Identical and Related Proteins

Unique RefSeq proteins for LMP014178 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109065802 RefSeq XP_001084531 375 G protein-coupled estrogen receptor 1

Identical Sequences to LMP014178 proteins

Reference Database Accession Length Protein Name
GI:109065802 GenBank EHH17092.1 375 hypothetical protein EGK_13399 [Macaca mulatta]
GI:109065802 GenBank EHH51961.1 375 hypothetical protein EGM_12306 [Macaca fascicularis]
GI:109065802 RefSeq XP_005549035.1 375 PREDICTED: G-protein coupled estrogen receptor 1 [Macaca fascicularis]
GI:109065802 SwissProt F7EQ49.1 375 RecName: Full=G-protein coupled estrogen receptor 1; AltName: Full=G protein-coupled estrogen receptor 1; AltName: Full=G-protein coupled receptor 30 [Macaca mulatta]

Related Sequences to LMP014178 proteins

Reference Database Accession Length Protein Name