Gene/Proteome Database (LMPD)
LMPD ID
LMP014179
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
Alternate Names
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1;
Chromosome
8
Map Location
chromosome:8
Proteins
| glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor | |
|---|---|
| Refseq ID | NP_001253455 |
| Protein GI | 388452852 |
| UniProt ID | G7N081 |
| mRNA ID | NM_001266526 |
| Length | 184 |
| Protein sequence is identical to GI:109087668 (mRNA isoform) | |
| sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2322 peptide sequence: MKVLRALLLALLLCGQPGRGQA | |
| Refseq ID | XP_001085384 |
| Protein GI | 109087668 |
| UniProt ID | G7N081 |
| mRNA ID | XM_001085384 |
| Length | 184 |
| MKVLRALLLALLLCGQPGRGQAQQEEEDEDEDHRLDDDDEEDEDEVEEEETNRLPGGRGRVLLWCYTCQSLSRDEHCNLTRSCSHGQACTTLIAHGNTESGLLTTHSAWCTDNCQPITKTVEGTQVTTTCCQFNLCNVPPWQSSRVQDPPGKGAGGPRGSCETAGTALLLNLLAGLGAMGAGRP | |
| sig_peptide: 1..22 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2322 peptide sequence: MKVLRALLLALLLCGQPGRGQA | |
Gene Information
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Protein Entry
G7N081_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014179 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109087668 | RefSeq | XP_001085384 | 184 | glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 |
Identical Sequences to LMP014179 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:388452852 | GenBank | EHH28807.1 | 184 | Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 [Macaca mulatta] |
| GI:388452852 | GenBank | EHH62463.1 | 184 | Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 [Macaca fascicularis] |
| GI:388452852 | GenBank | AFE76079.1 | 184 | glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor [Macaca mulatta] |
| GI:388452852 | GenBank | AFI35289.1 | 184 | glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 precursor [Macaca mulatta] |
Related Sequences to LMP014179 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|