Gene/Proteome Database (LMPD)
Proteins
glutathione peroxidase precursor | |
---|---|
Refseq ID | NP_001152830 |
Protein GI | 226817308 |
mRNA ID | NM_001159358 |
Length | 221 |
MIRQFQACCLVLLFLVGFAQQTLKPQNRKVDCNKRVTGTIYEYGALTLNSEEYIQFKQFAGKHVLFVNVATYUGLAAQYPELNALQEELKNFGVVVLAFPCNQFGKQEPGTNSEILLGLKYVRPGSGFVPNFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIRWNFEKFLVGPDGVPVMRWFHRAPVSTVKSDILEYLKQFNAH | |
sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2429 peptide sequence: MIRQFQACCLVLLFLVGFAQQ |
Gene Information
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Gene Name
glutathione peroxidase 6 (olfactory)
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014192 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
226817308 | RefSeq | NP_001152830 | 221 | glutathione peroxidase precursor |
Identical Sequences to LMP014192 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014192 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:226817308 | GenBank | AAY68223.1 | 221 | glutathione peroxidase 6 (olfactory) [Homo sapiens] |
GI:226817308 | RefSeq | XP_003897298.1 | 221 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 6 [Papio anubis] |
GI:226817308 | RefSeq | XP_005553771.1 | 221 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 6 [Macaca fascicularis] |
GI:226817308 | RefSeq | XP_007971535.1 | 257 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 6 [Chlorocebus sabaeus] |