Gene/Proteome Database (LMPD)

LMPD ID
LMP014225
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Gene Symbol
Alternate Names
hydroxyprostaglandin dehydrogenase 15-(NAD);
Chromosome
5
Map Location
chromosome:5

Proteins

Refseq ID XP_001087957
Protein GI 109076215
UniProt ID F6U1R8
mRNA ID XM_001087957
Length 266
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEKFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDATPFQAKSQ

Gene Information

Entrez Gene ID
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016323 IEA:Ensembl C basolateral plasma membrane
GO:0005737 ISS:UniProtKB C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016404 ISS:UniProtKB F 15-hydroxyprostaglandin dehydrogenase (NAD+) activity
GO:0051287 ISS:UniProtKB F NAD binding
GO:0070403 ISS:UniProtKB F NAD+ binding
GO:0003824 ISS:UniProtKB F catalytic activity
GO:0004957 ISS:UniProtKB F prostaglandin E receptor activity
GO:0097070 ISS:UniProtKB P ductus arteriosus closure
GO:0007565 ISS:UniProtKB P female pregnancy
GO:0045786 ISS:UniProtKB P negative regulation of cell cycle
GO:0030728 ISS:UniProtKB P ovulation
GO:0055114 ISS:GOC P oxidation-reduction process
GO:0007567 ISS:UniProtKB P parturition
GO:0006693 ISS:UniProtKB P prostaglandin metabolic process
GO:0070493 ISS:UniProtKB P thrombin receptor signaling pathway
GO:0007179 ISS:UniProtKB P transforming growth factor beta receptor signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
ko05202 Transcriptional misregulation in cancer
mcc05202 Transcriptional misregulation in cancer

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Protein Entry
F6U1R8_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Identical and Related Proteins

Unique RefSeq proteins for LMP014225 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109076215 RefSeq XP_001087957 266 hydroxyprostaglandin dehydrogenase 15-(NAD)

Identical Sequences to LMP014225 proteins

Reference Database Accession Length Protein Name
GI:109076215 DBBJ BAB97215.1 266 prostaglandin dehydrogenase I [Macaca fascicularis]
GI:109076215 GenBank EHH54072.1 266 hypothetical protein EGM_14822 [Macaca fascicularis]
GI:109076215 SwissProt Q8MJY8.1 266 RecName: Full=15-hydroxyprostaglandin dehydrogenase [NAD(+)]; Short=15-PGDH; AltName: Full=Prostaglandin dehydrogenase 1 [Macaca fascicularis]

Related Sequences to LMP014225 proteins

Reference Database Accession Length Protein Name
GI:109076215 RefSeq NP_001272271.1 266 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Macaca fascicularis]