Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001087957 |
Protein GI | 109076215 |
UniProt ID | F6U1R8 |
mRNA ID | XM_001087957 |
Length | 266 |
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEKFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDATPFQAKSQ |
Gene Information
Entrez Gene ID
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016323 | IEA:Ensembl | C | basolateral plasma membrane |
GO:0005737 | ISS:UniProtKB | C | cytoplasm |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016404 | ISS:UniProtKB | F | 15-hydroxyprostaglandin dehydrogenase (NAD+) activity |
GO:0051287 | ISS:UniProtKB | F | NAD binding |
GO:0070403 | ISS:UniProtKB | F | NAD+ binding |
GO:0003824 | ISS:UniProtKB | F | catalytic activity |
GO:0004957 | ISS:UniProtKB | F | prostaglandin E receptor activity |
GO:0097070 | ISS:UniProtKB | P | ductus arteriosus closure |
GO:0007565 | ISS:UniProtKB | P | female pregnancy |
GO:0045786 | ISS:UniProtKB | P | negative regulation of cell cycle |
GO:0030728 | ISS:UniProtKB | P | ovulation |
GO:0055114 | ISS:GOC | P | oxidation-reduction process |
GO:0007567 | ISS:UniProtKB | P | parturition |
GO:0006693 | ISS:UniProtKB | P | prostaglandin metabolic process |
GO:0070493 | ISS:UniProtKB | P | thrombin receptor signaling pathway |
GO:0007179 | ISS:UniProtKB | P | transforming growth factor beta receptor signaling pathway |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxyprostaglandin dehydrogenase 15-(NAD)
Protein Entry
F6U1R8_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014225 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109076215 | RefSeq | XP_001087957 | 266 | hydroxyprostaglandin dehydrogenase 15-(NAD) |
Identical Sequences to LMP014225 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109076215 | DBBJ | BAB97215.1 | 266 | prostaglandin dehydrogenase I [Macaca fascicularis] |
GI:109076215 | GenBank | EHH54072.1 | 266 | hypothetical protein EGM_14822 [Macaca fascicularis] |
GI:109076215 | SwissProt | Q8MJY8.1 | 266 | RecName: Full=15-hydroxyprostaglandin dehydrogenase [NAD(+)]; Short=15-PGDH; AltName: Full=Prostaglandin dehydrogenase 1 [Macaca fascicularis] |
Related Sequences to LMP014225 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109076215 | RefSeq | NP_001272271.1 | 266 | 15-hydroxyprostaglandin dehydrogenase [NAD(+)] [Macaca fascicularis] |