Gene/Proteome Database (LMPD)
Proteins
| estradiol 17-beta-dehydrogenase 8 | |
|---|---|
| Refseq ID | NP_001108430 |
| Protein GI | 169234984 |
| UniProt ID | Q8WMN4 |
| mRNA ID | NM_001114958 |
| Length | 261 |
| MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDGAAAQETVQLLGGPGNKEGPPRGNHAAFQADVSEARAARRLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSSGCRGSIINISSITGKVGNMGQTNYVASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGYLGDPEDVADVVAFLASEDSGYITGASVEVTGGLFM | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016491 | IEA:InterPro | F | oxidoreductase activity |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 8
Protein Entry
Q8WMN4_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014237 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 169234984 | RefSeq | NP_001108430 | 261 | estradiol 17-beta-dehydrogenase 8 |
Identical Sequences to LMP014237 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:169234984 | EMBL | CAD18906.1 | 261 | FabG-like protein [Macaca mulatta] |
| GI:169234984 | GenBank | AFE66926.1 | 261 | estradiol 17-beta-dehydrogenase 8 [Macaca mulatta] |
| GI:169234984 | GenBank | AFH30004.1 | 261 | estradiol 17-beta-dehydrogenase 8 [Macaca mulatta] |
Related Sequences to LMP014237 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:169234984 | RefSeq | XP_007971160.1 | 261 | PREDICTED: estradiol 17-beta-dehydrogenase 8 [Chlorocebus sabaeus] |