Gene/Proteome Database (LMPD)
Proteins
| isoamyl acetate-hydrolyzing esterase 1 homolog precursor | |
|---|---|
| Refseq ID | NP_001180665 |
| Protein GI | 302565684 |
| UniProt ID | F7EV90 |
| mRNA ID | NM_001193736 |
| Length | 248 |
| Protein sequence is identical to GI:109101965 (mRNA isoform) | |
| sig_peptide: 1..5 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 566 peptide sequence: MALCE | |
| Refseq ID | XP_001084501 |
| Protein GI | 109101965 |
| UniProt ID | F7EV90 |
| mRNA ID | XM_001084501 |
| Length | 248 |
| MALCEAAGCGSALLWPRLLLFGDSITQFSFQQGGWGASLADKLVRKCDVLNRGFSGYNTRWAKIILPRLIRKGNSLDIPVAVTIFFGANDSALKDENPKQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEKECIIQGCKLNRLNSVVGEYANACLQVAQDCGTDVLDLWTLMQDSQDFSSYLSDGLHLSPKGNEFLFSHLWPLIEKKVSSLPLLLPYWRDVAEAKPELSLLGDGDH | |
| sig_peptide: 1..5 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 566 peptide sequence: MALCE | |
Gene Information
Entrez Gene ID
Gene Name
isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae)
Protein Entry
F7EV90_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014245 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109101965 | RefSeq | XP_001084501 | 248 | isoamyl acetate-hydrolyzing esterase 1 homolog (S. cerevisiae) |
Identical Sequences to LMP014245 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302565684 | GenBank | AFH30525.1 | 248 | isoamyl acetate-hydrolyzing esterase 1 homolog [Macaca mulatta] |
| GI:302565684 | GenBank | AFI35490.1 | 248 | isoamyl acetate-hydrolyzing esterase 1 homolog [Macaca mulatta] |
| GI:302565684 | RefSeq | XP_003908304.1 | 248 | PREDICTED: isoamyl acetate-hydrolyzing esterase 1 homolog isoform X1 [Papio anubis] |
| GI:302565684 | RefSeq | XP_005576646.1 | 248 | PREDICTED: isoamyl acetate-hydrolyzing esterase 1 homolog isoform X1 [Macaca fascicularis] |
Related Sequences to LMP014245 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|