Gene/Proteome Database (LMPD)
Proteins
| insulin-induced gene 2 protein | |
|---|---|
| Refseq ID | NP_001181710 |
| Protein GI | 302563383 |
| UniProt ID | F7HBW1 |
| mRNA ID | NM_001194781 |
| Length | 225 |
| Protein sequence is identical to GI:297266902 (mRNA isoform) | |
| Refseq ID | XP_002799450 |
| Protein GI | 297266902 |
| UniProt ID | F7HBW1 |
| mRNA ID | XM_002799405 |
| Length | 225 |
| MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATLVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYECKVIAEKSHQE | |
| Refseq ID | XP_002799451 |
| Protein GI | 297266904 |
| UniProt ID | F7HBW1 |
| mRNA ID | XM_002799405 |
| Length | 225 |
| Protein sequence is identical to GI:297266902 (mRNA isoform) | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008203 | IEA:UniProtKB-KW | P | cholesterol metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR025929 | Insulin-induced protein family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Mediates feedback control of cholesterol synthesis. |
| Similarity | Belongs to the INSIG family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014267 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 297266902 | RefSeq | XP_002799450 | 225 | insulin induced gene 2 |
Identical Sequences to LMP014267 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302563383 | RefSeq | XP_007962932.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Chlorocebus sabaeus] |
| GI:302563383 | RefSeq | XP_009183295.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Papio anubis] |
| GI:302563383 | RefSeq | XP_009183297.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Papio anubis] |
| GI:302563383 | RefSeq | XP_009183298.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Papio anubis] |
Related Sequences to LMP014267 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302563383 | RefSeq | NP_001162382.1 | 225 | insulin-induced gene 2 protein [Papio anubis] |
| GI:302563383 | RefSeq | XP_007962930.1 | 225 | PREDICTED: insulin-induced gene 2 protein isoform X1 [Chlorocebus sabaeus] |
| GI:302563383 | SwissProt | A9RA88.1 | 225 | RecName: Full=Insulin-induced gene 2 protein; Short=INSIG-2 [Papio anubis] |