Gene/Proteome Database (LMPD)
Proteins
3-ketodihydrosphingosine reductase precursor | |
---|---|
Refseq ID | NP_001244872 |
Protein GI | 383872796 |
UniProt ID | F7HPT5 |
mRNA ID | NM_001257943 |
Length | 332 |
Protein sequence is identical to GI:109122362 (mRNA isoform) | |
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2706 peptide sequence: MLLLAAAFLVAFVLLLYMVSPLISP |
Refseq ID | XP_001089855 |
Protein GI | 109122362 |
UniProt ID | F7HPT5 |
mRNA ID | XM_001089855 |
Length | 332 |
MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAMSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSEIADKTA | |
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2706 peptide sequence: MLLLAAAFLVAFVLLLYMVSPLISP |
Gene Information
Entrez Gene ID
Gene Name
3-ketodihydrosphingosine reductase
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0016020 | IEA:Ensembl | C | membrane |
GO:0047560 | IEA:Ensembl | F | 3-dehydrosphinganine reductase activity |
GO:0006666 | IEA:Ensembl | P | 3-keto-sphinganine metabolic process |
GO:0030148 | IEA:Ensembl | P | sphingolipid biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00094 | Ceramide biosynthesis |
mcc_M00094 | Ceramide biosynthesis |
mcc01100 | Metabolic pathways |
ko00600 | Sphingolipid metabolism |
mcc00600 | Sphingolipid metabolism |
M00099 | Sphingosine biosynthesis |
mcc_M00099 | Sphingosine biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
3-ketodihydrosphingosine reductase
Protein Entry
F7HPT5_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014285 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109122362 | RefSeq | XP_001089855 | 332 | 3-ketodihydrosphingosine reductase |
Identical Sequences to LMP014285 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383872796 | GenBank | AFI35448.1 | 332 | 3-ketodihydrosphingosine reductase precursor [Macaca mulatta] |
GI:383872796 | RefSeq | XP_003914502.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase [Papio anubis] |
GI:383872796 | RefSeq | XP_008012056.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Chlorocebus sabaeus] |
GI:383872796 | RefSeq | XP_010387105.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase [Rhinopithecus roxellana] |
Related Sequences to LMP014285 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383872796 | GenBank | AFE77530.1 | 332 | 3-ketodihydrosphingosine reductase precursor [Macaca mulatta] |
GI:383872796 | GenBank | AFH31823.1 | 332 | 3-ketodihydrosphingosine reductase precursor [Macaca mulatta] |