Gene/Proteome Database (LMPD)
Proteins
| 3-ketodihydrosphingosine reductase precursor | |
|---|---|
| Refseq ID | NP_001244872 |
| Protein GI | 383872796 |
| UniProt ID | F7HPT5 |
| mRNA ID | NM_001257943 |
| Length | 332 |
| Protein sequence is identical to GI:109122362 (mRNA isoform) | |
| sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2706 peptide sequence: MLLLAAAFLVAFVLLLYMVSPLISP | |
| Refseq ID | XP_001089855 |
| Protein GI | 109122362 |
| UniProt ID | F7HPT5 |
| mRNA ID | XM_001089855 |
| Length | 332 |
| MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAMSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSEIADKTA | |
| sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2706 peptide sequence: MLLLAAAFLVAFVLLLYMVSPLISP | |
Gene Information
Entrez Gene ID
Gene Name
3-ketodihydrosphingosine reductase
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0016020 | IEA:Ensembl | C | membrane |
| GO:0047560 | IEA:Ensembl | F | 3-dehydrosphinganine reductase activity |
| GO:0006666 | IEA:Ensembl | P | 3-keto-sphinganine metabolic process |
| GO:0030148 | IEA:Ensembl | P | sphingolipid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00094 | Ceramide biosynthesis |
| mcc_M00094 | Ceramide biosynthesis |
| mcc01100 | Metabolic pathways |
| ko00600 | Sphingolipid metabolism |
| mcc00600 | Sphingolipid metabolism |
| M00099 | Sphingosine biosynthesis |
| mcc_M00099 | Sphingosine biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
3-ketodihydrosphingosine reductase
Protein Entry
F7HPT5_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014285 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109122362 | RefSeq | XP_001089855 | 332 | 3-ketodihydrosphingosine reductase |
Identical Sequences to LMP014285 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:383872796 | GenBank | AFI35448.1 | 332 | 3-ketodihydrosphingosine reductase precursor [Macaca mulatta] |
| GI:383872796 | RefSeq | XP_003914502.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase [Papio anubis] |
| GI:383872796 | RefSeq | XP_008012056.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Chlorocebus sabaeus] |
| GI:383872796 | RefSeq | XP_010387105.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase [Rhinopithecus roxellana] |
Related Sequences to LMP014285 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:383872796 | GenBank | AFE77530.1 | 332 | 3-ketodihydrosphingosine reductase precursor [Macaca mulatta] |
| GI:383872796 | GenBank | AFH31823.1 | 332 | 3-ketodihydrosphingosine reductase precursor [Macaca mulatta] |