Gene/Proteome Database (LMPD)

LMPD ID
LMP014285
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
3-ketodihydrosphingosine reductase
Gene Symbol
Alternate Names
3-ketodihydrosphingosine reductase;
Chromosome
18
Map Location
chromosome:18

Proteins

3-ketodihydrosphingosine reductase precursor
Refseq ID NP_001244872
Protein GI 383872796
UniProt ID F7HPT5
mRNA ID NM_001257943
Length 332
Protein sequence is identical to GI:109122362 (mRNA isoform)
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2706 peptide sequence: MLLLAAAFLVAFVLLLYMVSPLISP
Refseq ID XP_001089855
Protein GI 109122362
UniProt ID F7HPT5
mRNA ID XM_001089855
Length 332
MLLLAAAFLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAMSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSEIADKTA
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2706 peptide sequence: MLLLAAAFLVAFVLLLYMVSPLISP

Gene Information

Entrez Gene ID
Gene Name
3-ketodihydrosphingosine reductase
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016020 IEA:Ensembl C membrane
GO:0047560 IEA:Ensembl F 3-dehydrosphinganine reductase activity
GO:0006666 IEA:Ensembl P 3-keto-sphinganine metabolic process
GO:0030148 IEA:Ensembl P sphingolipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00094 Ceramide biosynthesis
mcc_M00094 Ceramide biosynthesis
mcc01100 Metabolic pathways
ko00600 Sphingolipid metabolism
mcc00600 Sphingolipid metabolism
M00099 Sphingosine biosynthesis
mcc_M00099 Sphingosine biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
3-ketodihydrosphingosine reductase
Protein Entry
F7HPT5_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014285 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109122362 RefSeq XP_001089855 332 3-ketodihydrosphingosine reductase

Identical Sequences to LMP014285 proteins

Reference Database Accession Length Protein Name
GI:383872796 GenBank AFI35448.1 332 3-ketodihydrosphingosine reductase precursor [Macaca mulatta]
GI:383872796 RefSeq XP_003914502.1 332 PREDICTED: 3-ketodihydrosphingosine reductase [Papio anubis]
GI:383872796 RefSeq XP_008012056.1 332 PREDICTED: 3-ketodihydrosphingosine reductase isoform X1 [Chlorocebus sabaeus]
GI:383872796 RefSeq XP_010387105.1 332 PREDICTED: 3-ketodihydrosphingosine reductase [Rhinopithecus roxellana]

Related Sequences to LMP014285 proteins

Reference Database Accession Length Protein Name
GI:383872796 GenBank AFE77530.1 332 3-ketodihydrosphingosine reductase precursor [Macaca mulatta]
GI:383872796 GenBank AFH31823.1 332 3-ketodihydrosphingosine reductase precursor [Macaca mulatta]