Gene/Proteome Database (LMPD)

LMPD ID
LMP014354
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
methylmalonyl CoA epimerase
Gene Symbol
Alternate Names
methylmalonyl CoA epimerase;
Chromosome
13
Map Location
chromosome:13

Proteins

Refseq ID XP_001102303
Protein GI 109103318
UniProt ID F6VQY5
mRNA ID XM_001102303
Length 176
MARALRAAAGNAIGLFSRLQAPIPTLRASSTSQPLDQVAGSLWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKTKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA

Gene Information

Entrez Gene ID
Gene Name
methylmalonyl CoA epimerase
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:Ensembl C mitochondrion
GO:0004493 IEA:Ensembl F methylmalonyl-CoA epimerase activity
GO:0046491 IEA:Ensembl P L-methylmalonyl-CoA metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko01200 Carbon metabolism
mcc01200 Carbon metabolism
ko00630 Glyoxylate and dicarboxylate metabolism
mcc00630 Glyoxylate and dicarboxylate metabolism
mcc01100 Metabolic pathways
ko00640 Propanoate metabolism
mcc00640 Propanoate metabolism
ko00280 Valine, leucine and isoleucine degradation
mcc00280 Valine, leucine and isoleucine degradation

Domain Information

InterPro Annotations

Accession Description
IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
IPR017515 Methylmalonyl-CoA epimerase

UniProt Annotations

Entry Information

Gene Name
methylmalonyl CoA epimerase
Protein Entry
F6VQY5_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014354 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109103318 RefSeq XP_001102303 176 methylmalonyl CoA epimerase

Identical Sequences to LMP014354 proteins

Reference Database Accession Length Protein Name
GI:109103318 RefSeq XP_005575690.1 176 PREDICTED: methylmalonyl-CoA epimerase, mitochondrial isoform X1 [Macaca fascicularis]

Related Sequences to LMP014354 proteins

Reference Database Accession Length Protein Name
GI:109103318 GenBank AAK52052.1 176 methylmalonyl-CoA epimerase [Homo sapiens]
GI:109103318 RefSeq XP_007968479.1 176 PREDICTED: methylmalonyl-CoA epimerase, mitochondrial isoform X1 [Chlorocebus sabaeus]
GI:109103318 SwissProt Q96PE7.1 176 RecName: Full=Methylmalonyl-CoA epimerase, mitochondrial; AltName: Full=DL-methylmalonyl-CoA racemase; Flags: Precursor [Homo sapiens]