Gene/Proteome Database (LMPD)

LMPD ID
LMP014448
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 1;
Chromosome
4
Map Location
chromosome:4

Proteins

diphosphoinositol polyphosphate phosphohydrolase 1
Refseq ID NP_001181643
Protein GI 302565232
UniProt ID F7CRJ0
mRNA ID NM_001194714
Length 172
Protein sequence is identical to GI:109070816 (mRNA isoform)
Refseq ID XP_001116464
Protein GI 109070816
UniProt ID F7CRJ0
mRNA ID XM_001116464
Length 172
MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

Gene Information

Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0008486 IEA:Ensembl F diphosphoinositol-polyphosphate diphosphatase activity
GO:0000287 IEA:Ensembl F magnesium ion binding
GO:0071544 IEA:Ensembl P diphosphoinositol polyphosphate catabolic process

Domain Information

InterPro Annotations

Accession Description
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like
IPR020084 NUDIX hydrolase, conserved site

UniProt Annotations

Entry Information

Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Protein Entry
F7CRJ0_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014448 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109070816 RefSeq XP_001116464 172 nudix (nucleoside diphosphate linked moiety X)-type motif 3

Identical Sequences to LMP014448 proteins

Reference Database Accession Length Protein Name
GI:302565232 GenBank AIC50829.1 172 NUDT3, partial [synthetic construct]
GI:302565232 RefSeq XP_008958861.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Pan paniscus]
GI:302565232 RefSeq XP_010356372.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Rhinopithecus roxellana]
GI:302565232 RefSeq XP_010356373.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Rhinopithecus roxellana]

Related Sequences to LMP014448 proteins

Reference Database Accession Length Protein Name
GI:302565232 GenBank AFE76477.1 172 diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca mulatta]
GI:302565232 GenBank AFH30951.1 172 diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca mulatta]
GI:302565232 GenBank AFI36133.1 172 diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca mulatta]
GI:302565232 RefSeq XP_005553319.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca fascicularis]