Gene/Proteome Database (LMPD)
Proteins
| diphosphoinositol polyphosphate phosphohydrolase 1 | |
|---|---|
| Refseq ID | NP_001181643 |
| Protein GI | 302565232 |
| UniProt ID | F7CRJ0 |
| mRNA ID | NM_001194714 |
| Length | 172 |
| Protein sequence is identical to GI:109070816 (mRNA isoform) | |
| Refseq ID | XP_001116464 |
| Protein GI | 109070816 |
| UniProt ID | F7CRJ0 |
| mRNA ID | XM_001116464 |
| Length | 172 |
| MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR | |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0008486 | IEA:Ensembl | F | diphosphoinositol-polyphosphate diphosphatase activity |
| GO:0000287 | IEA:Ensembl | F | magnesium ion binding |
| GO:0071544 | IEA:Ensembl | P | diphosphoinositol polyphosphate catabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Protein Entry
F7CRJ0_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014448 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109070816 | RefSeq | XP_001116464 | 172 | nudix (nucleoside diphosphate linked moiety X)-type motif 3 |
Identical Sequences to LMP014448 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302565232 | GenBank | AIC50829.1 | 172 | NUDT3, partial [synthetic construct] |
| GI:302565232 | RefSeq | XP_008958861.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Pan paniscus] |
| GI:302565232 | RefSeq | XP_010356372.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Rhinopithecus roxellana] |
| GI:302565232 | RefSeq | XP_010356373.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Rhinopithecus roxellana] |
Related Sequences to LMP014448 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:302565232 | GenBank | AFE76477.1 | 172 | diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca mulatta] |
| GI:302565232 | GenBank | AFH30951.1 | 172 | diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca mulatta] |
| GI:302565232 | GenBank | AFI36133.1 | 172 | diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca mulatta] |
| GI:302565232 | RefSeq | XP_005553319.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca fascicularis] |