Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001114587 |
Protein GI | 109106718 |
mRNA ID | XM_001114587 |
Length | 169 |
MAALKLLSSGLRLCASARGSRGAWYKRCVCSFSTSAHRHTKFYTDPVEAVKDIPDGATVLVGGFGLCGIPENLIGALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMISSYVGENAEFERQYLSGELEVELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGG |
Gene Information
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Gene Name
3-oxoacid CoA transferase 1
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014469 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109106718 | RefSeq | XP_001114587 | 169 |
Identical Sequences to LMP014469 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP014469 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109106718 | GenBank | EHH26468.1 | 520 | Succinyl-CoA:3-ketoacid-coenzyme A transferase 1, mitochondrial [Macaca mulatta] |
GI:109106718 | GenBank | JAA02979.1 | 520 | 3-oxoacid CoA transferase 1 [Pan troglodytes] |
GI:109106718 | RefSeq | XP_005578941.1 | 236 | PREDICTED: succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial-like [Macaca fascicularis] |
GI:109106718 | RefSeq | XP_009447466.1 | 520 | PREDICTED: succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial isoform X1 [Pan troglodytes] |