Gene/Proteome Database (LMPD)

LMPD ID
LMP014508
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
prenyl (decaprenyl) diphosphate synthase, subunit 1
Gene Symbol
Alternate Names
prenyl (decaprenyl) diphosphate synthase, subunit 1;
Chromosome
9
Map Location
chromosome:9

Proteins

Refseq ID XP_001102166
Protein GI 109088459
UniProt ID F7C4K8
mRNA ID XM_001102166
Length 415
MASRWWRWLRGCSWRPAARSPGPGCPGLAGPRGPQAAADAHAQVHRRKGLHLSQIPYINLVKHLTSACPNVYSISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRTIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK

Gene Information

Entrez Gene ID
Gene Name
prenyl (decaprenyl) diphosphate synthase, subunit 1
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:Ensembl C mitochondrion
GO:0000010 IEA:Ensembl F trans-hexaprenyltranstransferase activity
GO:0050347 IEA:Ensembl F trans-octaprenyltranstransferase activity
GO:0008299 IEA:UniProtKB-KW P isoprenoid biosynthetic process
GO:0051290 IEA:Ensembl P protein heterotetramerization

KEGG Pathway Links

KEGG Pathway ID Description
ko00900 Terpenoid backbone biosynthesis
mcc00900 Terpenoid backbone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR008949 Isoprenoid synthase domain
IPR000092 Polyprenyl synthetase
IPR017446 Polyprenyl synthetase-related

UniProt Annotations

Entry Information

Gene Name
prenyl (decaprenyl) diphosphate synthase, subunit 1
Protein Entry
F7C4K8_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Belongs to the FPP/GGPP synthase family.

Identical and Related Proteins

Unique RefSeq proteins for LMP014508 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109088459 RefSeq XP_001102166 415 prenyl (decaprenyl) diphosphate synthase, subunit 1

Identical Sequences to LMP014508 proteins

Reference Database Accession Length Protein Name
GI:109088459 RefSeq XP_005564888.1 415 PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Macaca fascicularis]

Related Sequences to LMP014508 proteins

Reference Database Accession Length Protein Name
GI:109088459 RefSeq XP_003903528.1 415 PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Papio anubis]
GI:109088459 RefSeq XP_008000786.1 415 PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Chlorocebus sabaeus]
GI:109088459 RefSeq XP_010379755.1 415 PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Rhinopithecus roxellana]