Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001102166 |
Protein GI | 109088459 |
UniProt ID | F7C4K8 |
mRNA ID | XM_001102166 |
Length | 415 |
MASRWWRWLRGCSWRPAARSPGPGCPGLAGPRGPQAAADAHAQVHRRKGLHLSQIPYINLVKHLTSACPNVYSISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSELKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRTIALIAEMIHTASLVHDDVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK |
Gene Information
Entrez Gene ID
Gene Name
prenyl (decaprenyl) diphosphate synthase, subunit 1
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0000010 | IEA:Ensembl | F | trans-hexaprenyltranstransferase activity |
GO:0050347 | IEA:Ensembl | F | trans-octaprenyltranstransferase activity |
GO:0008299 | IEA:UniProtKB-KW | P | isoprenoid biosynthetic process |
GO:0051290 | IEA:Ensembl | P | protein heterotetramerization |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
prenyl (decaprenyl) diphosphate synthase, subunit 1
Protein Entry
F7C4K8_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Belongs to the FPP/GGPP synthase family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014508 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109088459 | RefSeq | XP_001102166 | 415 | prenyl (decaprenyl) diphosphate synthase, subunit 1 |
Identical Sequences to LMP014508 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109088459 | RefSeq | XP_005564888.1 | 415 | PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Macaca fascicularis] |
Related Sequences to LMP014508 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109088459 | RefSeq | XP_003903528.1 | 415 | PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Papio anubis] |
GI:109088459 | RefSeq | XP_008000786.1 | 415 | PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Chlorocebus sabaeus] |
GI:109088459 | RefSeq | XP_010379755.1 | 415 | PREDICTED: decaprenyl-diphosphate synthase subunit 1 [Rhinopithecus roxellana] |