Gene/Proteome Database (LMPD)
Proteins
| phosphatidylinositol N-acetylglucosaminyltransferase subunit C | |
|---|---|
| Refseq ID | NP_001248179 |
| Protein GI | 386781759 |
| UniProt ID | F7FCE6 |
| mRNA ID | NM_001261250 |
| Length | 297 |
| Protein sequence is identical to GI:109019525 (mRNA isoform) | |
| Refseq ID | XP_001100450 |
| Protein GI | 109019525 |
| UniProt ID | F7FCE6 |
| mRNA ID | XM_001100450 |
| Length | 297 |
| MCAQPVTSTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLFGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSALGGLLSISAVGAILFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000506 | IEA:Ensembl | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0017176 | IEA:InterPro | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
| GO:0006506 | IEA:InterPro | P | GPI anchor biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009450 | Phosphatidylinositol N-acetylglucosaminyltransferase subunit C |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Protein Entry
F7FCE6_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014544 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 109019525 | RefSeq | XP_001100450 | 297 | phosphatidylinositol glycan anchor biosynthesis, class C |
Identical Sequences to LMP014544 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781759 | RefSeq | XP_007987701.1 | 297 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Chlorocebus sabaeus] |
| GI:386781759 | RefSeq | XP_007987702.1 | 297 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Chlorocebus sabaeus] |
| GI:386781759 | RefSeq | XP_009192452.1 | 297 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Papio anubis] |
| GI:386781759 | RefSeq | XP_009192459.1 | 297 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Papio anubis] |
Related Sequences to LMP014544 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:386781759 | GenBank | AFI33514.1 | 297 | phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Macaca mulatta] |
| GI:386781759 | GenBank | AFI37450.1 | 297 | phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Macaca mulatta] |
| GI:386781759 | GenBank | AFI37453.1 | 297 | phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Macaca mulatta] |
| GI:386781759 | GenBank | AFJ70886.1 | 297 | phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Macaca mulatta] |