Gene/Proteome Database (LMPD)

LMPD ID
LMP014544
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Alternate Names
phosphatidylinositol N-acetylglucosaminyltransferase subunit C;
Chromosome
1
Map Location
chromosome:1

Proteins

phosphatidylinositol N-acetylglucosaminyltransferase subunit C
Refseq ID NP_001248179
Protein GI 386781759
UniProt ID F7FCE6
mRNA ID NM_001261250
Length 297
Protein sequence is identical to GI:109019525 (mRNA isoform)
Refseq ID XP_001100450
Protein GI 109019525
UniProt ID F7FCE6
mRNA ID XM_001100450
Length 297
MCAQPVTSTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLFGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSALGGLLSISAVGAILFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000506 IEA:Ensembl C glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex
GO:0016021 IEA:InterPro C integral component of membrane
GO:0017176 IEA:InterPro F phosphatidylinositol N-acetylglucosaminyltransferase activity
GO:0006506 IEA:InterPro P GPI anchor biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
mcc00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR009450 Phosphatidylinositol N-acetylglucosaminyltransferase subunit C

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class C
Protein Entry
F7FCE6_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014544 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109019525 RefSeq XP_001100450 297 phosphatidylinositol glycan anchor biosynthesis, class C

Identical Sequences to LMP014544 proteins

Reference Database Accession Length Protein Name
GI:386781759 RefSeq XP_007987701.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Chlorocebus sabaeus]
GI:386781759 RefSeq XP_007987702.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Chlorocebus sabaeus]
GI:386781759 RefSeq XP_009192452.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Papio anubis]
GI:386781759 RefSeq XP_009192459.1 297 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Papio anubis]

Related Sequences to LMP014544 proteins

Reference Database Accession Length Protein Name
GI:386781759 GenBank AFI33514.1 297 phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Macaca mulatta]
GI:386781759 GenBank AFI37450.1 297 phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Macaca mulatta]
GI:386781759 GenBank AFI37453.1 297 phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Macaca mulatta]
GI:386781759 GenBank AFJ70886.1 297 phosphatidylinositol N-acetylglucosaminyltransferase subunit C [Macaca mulatta]