Gene/Proteome Database (LMPD)
Proteins
phosphatidylinositol N-acetylglucosaminyltransferase subunit Y | |
---|---|
Refseq ID | NP_001252697 |
Protein GI | 388452932 |
UniProt ID | H9ERE7 |
mRNA ID | NM_001265768 |
Length | 71 |
Protein sequence is identical to GI:297293004 (mRNA isoform) |
Refseq ID | XP_002804177 |
Protein GI | 297293004 |
UniProt ID | H9ERE7 |
mRNA ID | XM_002804131 |
Length | 71 |
MFLSLPTLTVLIPLVSLTGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR029164 | Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Protein Entry
H9ERE7_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014557 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
297293004 | RefSeq | XP_002804177 | 71 | phosphatidylinositol glycan anchor biosynthesis, class Y |
Identical Sequences to LMP014557 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388452932 | RefSeq | XP_005555453.1 | 71 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X2 [Macaca fascicularis] |
GI:388452932 | RefSeq | XP_005555454.1 | 71 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X3 [Macaca fascicularis] |
GI:388452932 | RefSeq | XP_007997420.1 | 71 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Chlorocebus sabaeus] |
GI:388452932 | RefSeq | XP_009205426.1 | 71 | PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Papio anubis] |
Related Sequences to LMP014557 proteins
Reference | Database | Accession | Length | Protein Name |
---|