Gene/Proteome Database (LMPD)

LMPD ID
LMP014557
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Gene Symbol
Alternate Names
phosphatidylinositol N-acetylglucosaminyltransferase subunit Y;
Chromosome
5
Map Location
chromosome:5

Proteins

phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
Refseq ID NP_001252697
Protein GI 388452932
UniProt ID H9ERE7
mRNA ID NM_001265768
Length 71
Protein sequence is identical to GI:297293004 (mRNA isoform)
Refseq ID XP_002804177
Protein GI 297293004
UniProt ID H9ERE7
mRNA ID XM_002804131
Length 71
MFLSLPTLTVLIPLVSLTGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRHN

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description

KEGG Pathway Links

KEGG Pathway ID Description
ko00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
mcc00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR029164 Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class Y
Protein Entry
H9ERE7_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014557 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
297293004 RefSeq XP_002804177 71 phosphatidylinositol glycan anchor biosynthesis, class Y

Identical Sequences to LMP014557 proteins

Reference Database Accession Length Protein Name
GI:388452932 RefSeq XP_005555453.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X2 [Macaca fascicularis]
GI:388452932 RefSeq XP_005555454.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y-like isoform X3 [Macaca fascicularis]
GI:388452932 RefSeq XP_007997420.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Chlorocebus sabaeus]
GI:388452932 RefSeq XP_009205426.1 71 PREDICTED: phosphatidylinositol N-acetylglucosaminyltransferase subunit Y [Papio anubis]

Related Sequences to LMP014557 proteins

Reference Database Accession Length Protein Name