Gene/Proteome Database (LMPD)
Proteins
phosphatidylinositol transfer protein alpha isoform | |
---|---|
Refseq ID | NP_001247648 |
Protein GI | 386781617 |
UniProt ID | H9FVV5 |
mRNA ID | NM_001260719 |
Length | 270 |
Protein sequence is identical to GI:297271548 (mRNA isoform) |
Refseq ID | XP_002800284 |
Protein GI | 297271548 |
UniProt ID | H9FVV5 |
mRNA ID | XM_002800238 |
Length | 270 |
MVLLKEYRVILPVSVDEYQVGQLYSVAEASKNETGGGEGVEVLVNEPYEKDGEKGQYTHKIYHLQSKVPTFVRMLAPEGALNIHEKAWNAYPYCRTVITNEYMKEDFLIKIETWHKPDLGTLENVHKLEPETWKHVEAIYIDIADRSQVLSKDYKAEEDPAKFKSNKTGRGPLGPNWKQELVNQKDCPYMCAYKLVTVKFKWWGLQNKVENFIHKQERRLFTNFHRQLFCWLDKWVDLTMDDIRRMEEETKRQLDEMRQKDPVKGMTADD |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol transfer protein, alpha
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005622 | IEA:InterPro | C | intracellular |
GO:0006810 | IEA:InterPro | P | transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol transfer protein, alpha
Protein Entry
H9FVV5_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014579 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
297271548 | RefSeq | XP_002800284 | 270 | phosphatidylinositol transfer protein, alpha |
Identical Sequences to LMP014579 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386781617 | GenBank | AFH32821.1 | 270 | phosphatidylinositol transfer protein alpha isoform [Macaca mulatta] |
GI:386781617 | GenBank | AFI37460.1 | 270 | phosphatidylinositol transfer protein alpha isoform [Macaca mulatta] |
GI:386781617 | GenBank | AFI37461.1 | 270 | phosphatidylinositol transfer protein alpha isoform [Macaca mulatta] |
GI:386781617 | RefSeq | XP_005582492.1 | 270 | PREDICTED: phosphatidylinositol transfer protein alpha isoform [Macaca fascicularis] |
Related Sequences to LMP014579 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:386781617 | GenBank | AFE78765.1 | 270 | phosphatidylinositol transfer protein alpha isoform [Macaca mulatta] |
GI:386781617 | GenBank | AFH32820.1 | 270 | phosphatidylinositol transfer protein alpha isoform [Macaca mulatta] |