Gene/Proteome Database (LMPD)
Proteins
Refseq ID | XP_001088684 |
Protein GI | 109098947 |
UniProt ID | F6TIZ9 |
mRNA ID | XM_001088684 |
Length | 148 |
MKLLVLAVLLTVAAAESGISSRAVWQFRKLIKCVIPGSDPYLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLSSCKFLLDNPYTHTYSYSCSNSEITCSSKNKECEAFICNCDRNAAICFSKAPYNKEHKNLDSKKYCQS |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IB (pancreas)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009986 | IEA:Ensembl | C | cell surface |
GO:0005615 | IEA:Ensembl | C | extracellular space |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0047498 | IEA:Ensembl | F | calcium-dependent phospholipase A2 activity |
GO:0019731 | IEA:Ensembl | P | antibacterial humoral response |
GO:0050830 | IEA:Ensembl | P | defense response to Gram-positive bacterium |
GO:0006633 | IEA:Ensembl | P | fatty acid biosynthetic process |
GO:0002227 | IEA:Ensembl | P | innate immune response in mucosa |
GO:0044240 | IEA:Ensembl | P | multicellular organismal lipid catabolic process |
GO:0046470 | IEA:Ensembl | P | phosphatidylcholine metabolic process |
GO:0045740 | IEA:Ensembl | P | positive regulation of DNA replication |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko00590 | Arachidonic acid metabolism |
mcc00590 | Arachidonic acid metabolism |
ko00565 | Ether lipid metabolism |
mcc00565 | Ether lipid metabolism |
ko04975 | Fat digestion and absorption |
mcc04975 | Fat digestion and absorption |
ko00564 | Glycerophospholipid metabolism |
mcc00564 | Glycerophospholipid metabolism |
ko00591 | Linoleic acid metabolism |
mcc00591 | Linoleic acid metabolism |
mcc01100 | Metabolic pathways |
ko04972 | Pancreatic secretion |
mcc04972 | Pancreatic secretion |
mcc04014 | Ras signaling pathway |
ko04270 | Vascular smooth muscle contraction |
mcc04270 | Vascular smooth muscle contraction |
ko00592 | alpha-Linolenic acid metabolism |
mcc00592 | alpha-Linolenic acid metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group IB (pancreas)
Protein Entry
F6TIZ9_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. |
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Cofactor | Note=Binds 1 calcium ion per subunit. ; |
Similarity | Belongs to the phospholipase A2 family. |
Subcellular Location | Secreted |
Identical and Related Proteins
Unique RefSeq proteins for LMP014591 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109098947 | RefSeq | XP_001088684 | 148 | phospholipase A2, group IB (pancreas) |
Identical Sequences to LMP014591 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109098947 | RefSeq | XP_003907296.1 | 148 | PREDICTED: phospholipase A2 [Papio anubis] |
GI:109098947 | RefSeq | XP_005572452.1 | 148 | PREDICTED: phospholipase A2 isoform X2 [Macaca fascicularis] |
Related Sequences to LMP014591 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:109098947 | RefSeq | XP_008003124.1 | 148 | PREDICTED: phospholipase A2 [Chlorocebus sabaeus] |
GI:109098947 | SwissProt | P04054.3 | 148 | RecName: Full=Phospholipase A2; AltName: Full=Group IB phospholipase A2; AltName: Full=Phosphatidylcholine 2-acylhydrolase 1B; Flags: Precursor [Homo sapiens] |