Gene/Proteome Database (LMPD)

LMPD ID
LMP014628
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
Gene Symbol
Alternate Names
pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3;
Chromosome
12
Map Location
chromosome:12

Proteins

Refseq ID XP_001099197
Protein GI 109100232
UniProt ID F6WME3
mRNA ID XM_001099197
Length 300
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTRMELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSELRLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAKFKPEMFQLPHPDPLVSPVSPSPGQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRRRTYSDTDSCNDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKKSESEDTLPSFSS

Gene Information

Entrez Gene ID
Gene Name
pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:Ensembl C Golgi apparatus
GO:0005545 IEA:Ensembl F 1-phosphatidylinositol binding

Domain Information

InterPro Annotations

Accession Description
IPR001849 Pleckstrin homology domain
IPR011993 Pleckstrin homology-like domain

UniProt Annotations

Entry Information

Gene Name
pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3
Protein Entry
F6WME3_MACMU
UniProt ID
Species
Rhesus monkey

Comments

Comment Type Description
Caution The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data.
Similarity Contains 1 PH domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014628 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109100232 RefSeq XP_001099197 300 pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 3

Identical Sequences to LMP014628 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP014628 proteins

Reference Database Accession Length Protein Name
GI:109100232 GenBank AFE79772.1 300 pleckstrin homology domain-containing family A member 3 [Macaca mulatta]
GI:109100232 GenBank AFI33247.1 300 pleckstrin homology domain-containing family A member 3 [Macaca mulatta]
GI:109100232 RefSeq XP_003907718.1 300 PREDICTED: pleckstrin homology domain-containing family A member 3 [Papio anubis]
GI:109100232 RefSeq XP_007963662.1 300 PREDICTED: pleckstrin homology domain-containing family A member 3 [Chlorocebus sabaeus]