Gene/Proteome Database (LMPD)
Proteins
proteolipid protein 2 | |
---|---|
Refseq ID | NP_001252795 |
Protein GI | 388453808 |
UniProt ID | F6VM49 |
mRNA ID | NM_001265866 |
Length | 152 |
Protein sequence is identical to GI:109130707 (mRNA isoform) |
Refseq ID | XP_001106080 |
Protein GI | 109130707 |
UniProt ID | F6VM49 |
mRNA ID | XM_001106080 |
Length | 152 |
MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVVEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPFRQPRHTAAPTDPADGPV |
Gene Information
Entrez Gene ID
Gene Name
proteolipid protein 2 (colonic epithelium-enriched)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IEA:Ensembl | C | plasma membrane |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR008253 | Marvel domain |
UniProt Annotations
Entry Information
Gene Name
proteolipid protein 2 (colonic epithelium-enriched)
Protein Entry
F6VM49_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014633 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109130707 | RefSeq | XP_001106080 | 152 | proteolipid protein 2 (colonic epithelium-enriched) |
Identical Sequences to LMP014633 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388453808 | GenBank | AFI35600.1 | 152 | proteolipid protein 2 [Macaca mulatta] |
GI:388453808 | RefSeq | XP_003917750.1 | 152 | PREDICTED: proteolipid protein 2 [Papio anubis] |
GI:388453808 | RefSeq | XP_009195840.1 | 152 | PREDICTED: proteolipid protein 2 [Papio anubis] |
GI:388453808 | RefSeq | XP_010360910.1 | 152 | PREDICTED: proteolipid protein 2 [Rhinopithecus roxellana] |
Related Sequences to LMP014633 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:388453808 | GenBank | EHH30720.1 | 152 | Intestinal membrane A4 protein [Macaca mulatta] |