Gene/Proteome Database (LMPD)

LMPD ID
LMP014660
Gene ID
613250
Species
Macaca mulatta (Rhesus monkey)
Gene Name
peroxisome proliferator-activated receptor alpha
Gene Symbol
PPARA
Alternate Names
peroxisome proliferator-activated receptor alpha; peroxisome proliferator activated receptor, alpha;
Chromosome
10
Map Location
chromosome:10

Proteins

peroxisome proliferator-activated receptor alpha
Refseq ID NP_001028201
Protein GI 74271871
UniProt ID Q4PNY3
mRNA ID NM_001033029
Length 467
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFSFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKTESDAALHPLLQEIYRDMY

Gene Information

Entrez Gene ID
613250
Gene Name
peroxisome proliferator-activated receptor alpha
Gene Symbol
PPARA
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0000978 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001078 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription
GO:0001077 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0001190 IEA:Ensembl F RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription
GO:0008144 IEA:Ensembl F drug binding
GO:0004879 IEA:Ensembl F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0008289 IEA:Ensembl F lipid binding
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0032922 IEA:Ensembl P circadian regulation of gene expression
GO:0070166 IEA:Ensembl P enamel mineralization
GO:0008544 IEA:Ensembl P epidermis development
GO:0032099 IEA:Ensembl P negative regulation of appetite
GO:0010887 IEA:Ensembl P negative regulation of cholesterol storage
GO:0010871 IEA:Ensembl P negative regulation of receptor biosynthetic process
GO:0010891 IEA:Ensembl P negative regulation of sequestering of triglyceride
GO:0046321 IEA:Ensembl P positive regulation of fatty acid oxidation
GO:0045722 IEA:Ensembl P positive regulation of gluconeogenesis
GO:0072366 IEA:Ensembl P regulation of cellular ketone metabolic process by positive regulation of transcription from RNA polymerase II promoter
GO:0042752 IEA:Ensembl P regulation of circadian rhythm
GO:0072363 IEA:Ensembl P regulation of glycolytic by positive regulation of transcription from RNA polymerase II promoter
GO:0072369 IEA:Ensembl P regulation of lipid transport by positive regulation of transcription from RNA polymerase II promoter
GO:0042060 IEA:Ensembl P wound healing

KEGG Pathway Links

KEGG Pathway ID Description
ko04920 Adipocytokine signaling pathway
mcc04920 Adipocytokine signaling pathway
ko05160 Hepatitis C
mcc05160 Hepatitis C
ko04932 Non-alcoholic fatty liver disease (NAFLD)
mcc04932 Non-alcoholic fatty liver disease (NAFLD)
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway
ko04024 cAMP signaling pathway
mcc04024 cAMP signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003074 Peroxisome proliferator-activated receptor
IPR003076 Peroxisome proliferator-activated receptor, alpha
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
peroxisome proliferator-activated receptor alpha
Protein Entry
Q4PNY3_MACMU
UniProt ID
Q4PNY3
Species
Rhesus monkey

Comments

Comment Type Description
Similarity Belongs to the nuclear hormone receptor family.
Similarity Contains nuclear receptor DNA-binding domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014660 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
74271871 RefSeq NP_001028201 467 peroxisome proliferator-activated receptor alpha

Identical Sequences to LMP014660 proteins

Reference Database Accession Length Protein Name
GI:74271871 GenBank AAY64435.1 467 peroxisome proliferator activated receptor [Macaca mulatta]
GI:74271871 GenBank AFH32905.1 467 peroxisome proliferator-activated receptor alpha [Macaca mulatta]

Related Sequences to LMP014660 proteins

Reference Database Accession Length Protein Name
GI:74271871 GenBank EHH65928.1 467 hypothetical protein EGM_02801 [Macaca fascicularis]
GI:74271871 RefSeq XP_009215771.1 467 PREDICTED: peroxisome proliferator-activated receptor alpha [Papio anubis]