Gene/Proteome Database (LMPD)

LMPD ID
LMP014660
Gene ID
613250
Species
Macaca mulatta (Rhesus monkey)
Gene Name
peroxisome proliferator-activated receptor alpha
Gene Symbol
PPARA
Alternate Names
peroxisome proliferator-activated receptor alpha; peroxisome proliferator activated receptor, alpha;
Chromosome
10
Map Location
chromosome:10

Proteins

peroxisome proliferator-activated receptor alpha
Refseq ID NP_001028201
Protein GI 74271871
UniProt ID Q4PNY3
mRNA ID NM_001033029
Length 467
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFSFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKTESDAALHPLLQEIYRDMY

Gene Information

Entrez Gene ID
613250
Gene Name
peroxisome proliferator-activated receptor alpha
Gene Symbol
PPARA
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0008144 IEA:Ensembl F drug binding
GO:0004879 IEA:Ensembl F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0008289 IEA:Ensembl F lipid binding
GO:0000978 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001078 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription
GO:0001077 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0001190 IEA:Ensembl F RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0032922 IEA:Ensembl P circadian regulation of gene expression
GO:0070166 IEA:Ensembl P enamel mineralization
GO:0008544 IEA:Ensembl P epidermis development
GO:0032099 IEA:Ensembl P negative regulation of appetite
GO:0010887 IEA:Ensembl P negative regulation of cholesterol storage
GO:0010871 IEA:Ensembl P negative regulation of receptor biosynthetic process
GO:0010891 IEA:Ensembl P negative regulation of sequestering of triglyceride
GO:0046321 IEA:Ensembl P positive regulation of fatty acid oxidation
GO:0045722 IEA:Ensembl P positive regulation of gluconeogenesis
GO:0072366 IEA:Ensembl P regulation of cellular ketone metabolic process by positive regulation of transcription from RNA polymerase II promoter
GO:0042752 IEA:Ensembl P regulation of circadian rhythm
GO:0072363 IEA:Ensembl P regulation of glycolytic by positive regulation of transcription from RNA polymerase II promoter
GO:0072369 IEA:Ensembl P regulation of lipid transport by positive regulation of transcription from RNA polymerase II promoter
GO:0042060 IEA:Ensembl P wound healing

KEGG Pathway Links

KEGG Pathway ID Description
ko04920 Adipocytokine signaling pathway
mcc04920 Adipocytokine signaling pathway
ko04024 cAMP signaling pathway
mcc04024 cAMP signaling pathway
ko05160 Hepatitis C
mcc05160 Hepatitis C
ko04932 Non-alcoholic fatty liver disease (NAFLD)
mcc04932 Non-alcoholic fatty liver disease (NAFLD)
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003074 Peroxisome proliferator-activated receptor
IPR003076 Peroxisome proliferator-activated receptor, alpha
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
peroxisome proliferator-activated receptor alpha
Protein Entry
Q4PNY3_MACMU
UniProt ID
Q4PNY3
Species
Rhesus monkey

Comments

Comment Type Description
Similarity Belongs to the nuclear hormone receptor family.
Similarity Contains nuclear receptor DNA-binding domain.

Identical and Related Proteins

Unique RefSeq proteins for LMP014660 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
74271871 RefSeq NP_001028201 467 peroxisome proliferator-activated receptor alpha

Identical Sequences to LMP014660 proteins

Reference Database Accession Length Protein Name
GI:74271871 GenBank AAY64435.1 467 peroxisome proliferator activated receptor [Macaca mulatta]
GI:74271871 GenBank AFH32905.1 467 peroxisome proliferator-activated receptor alpha [Macaca mulatta]

Related Sequences to LMP014660 proteins

Reference Database Accession Length Protein Name
GI:74271871 GenBank EHH65928.1 467 hypothetical protein EGM_02801 [Macaca fascicularis]
GI:74271871 RefSeq XP_009215771.1 467 PREDICTED: peroxisome proliferator-activated receptor alpha [Papio anubis]