Gene/Proteome Database (LMPD)

LMPD ID
LMP014662
Gene ID
574190
Species
Macaca mulatta (Rhesus monkey)
Gene Name
peroxisome proliferator-activated receptor gamma
Gene Symbol
PPARG
Synonyms
PPARGAMMA;
Alternate Names
peroxisome proliferator-activated receptor gamma; PPAR-gamma; nuclear receptor subfamily 1 group C member 3; peroxisome proliferator-activated receptor gamma 1-a; peroxisome proliferator-activated receptor gamma 1-b;
Chromosome
2
Map Location
chromosome:2

Proteins

peroxisome proliferator-activated receptor gamma
Refseq ID NP_001028032
Protein GI 74136281
UniProt ID O18924
mRNA ID NM_001032860
Length 505
MGETLGDSPIDPESDSFTDTLSANISQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRTDPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Refseq ID NW_001112691
Protein GI 74136281
UniProt ID O18924
Length 505
MGETLGDSPIDPESDSFTDTLSANISQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRTDPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Gene Information

Entrez Gene ID
574190
Gene Name
peroxisome proliferator-activated receptor gamma
Gene Symbol
PPARG
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0005634 IEA:UniProtKB-KW C nucleus
GO:0003677 ISS:UniProtKB F DNA binding
GO:0001012 IEA:Ensembl F RNA polymerase II regulatory region DNA binding
GO:0001228 IEA:Ensembl F RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0003682 ISS:UniProtKB F chromatin binding
GO:0008144 IEA:Ensembl F drug binding
GO:0004879 IEA:InterPro F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0030374 ISS:UniProtKB F ligand-dependent nuclear receptor transcription coactivator activity
GO:0043565 IEA:InterPro F sequence-specific DNA binding
GO:0003700 ISS:UniProtKB F sequence-specific DNA binding transcription factor activity
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0044212 ISS:UniProtKB F transcription regulatory region DNA binding
GO:0008270 IEA:InterPro F zinc ion binding
GO:0006919 IEA:Ensembl P activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0050873 IEA:Ensembl P brown fat cell differentiation
GO:0045165 IEA:Ensembl P cell fate commitment
GO:0048469 IEA:Ensembl P cell maturation
GO:0032869 IEA:Ensembl P cellular response to insulin stimulus
GO:0071285 IEA:Ensembl P cellular response to lithium ion
GO:0030855 IEA:Ensembl P epithelial cell differentiation
GO:0042593 IEA:Ensembl P glucose homeostasis
GO:0042953 IEA:Ensembl P lipoprotein transport
GO:0015909 IEA:Ensembl P long-chain fatty acid transport
GO:0045713 IEA:Ensembl P low-density lipoprotein particle receptor biosynthetic process
GO:0030224 IEA:Ensembl P monocyte differentiation
GO:0010887 IEA:Ensembl P negative regulation of cholesterol storage
GO:0060336 IEA:Ensembl P negative regulation of interferon-gamma-mediated signaling pathway
GO:0010871 IEA:Ensembl P negative regulation of receptor biosynthetic process
GO:0010891 IEA:Ensembl P negative regulation of sequestering of triglyceride
GO:0048662 IEA:Ensembl P negative regulation of smooth muscle cell proliferation
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0035357 IEA:Ensembl P peroxisome proliferator activated receptor signaling pathway
GO:0001890 IEA:Ensembl P placenta development
GO:0045600 ISS:HGNC P positive regulation of fat cell differentiation
GO:0051091 IEA:Ensembl P positive regulation of sequence-specific DNA binding transcription factor activity
GO:0045944 ISS:UniProtKB P positive regulation of transcription from RNA polymerase II promoter
GO:0045893 ISS:UniProtKB P positive regulation of transcription, DNA-templated
GO:0008217 IEA:Ensembl P regulation of blood pressure
GO:0060850 ISS:UniProtKB P regulation of transcription involved in cell fate commitment
GO:0055098 IEA:Ensembl P response to low-density lipoprotein particle
GO:0032526 ISS:UniProtKB P response to retinoic acid
GO:0050872 ISS:HGNC P white fat cell differentiation

KEGG Pathway Links

KEGG Pathway ID Description
ko04152 AMPK signaling pathway
mcc04152 AMPK signaling pathway
ko05016 Huntington's disease
mcc05016 Huntington's disease
ko04380 Osteoclast differentiation
mcc04380 Osteoclast differentiation
ko03320 PPAR signaling pathway
mcc03320 PPAR signaling pathway
mcc05200 Pathways in cancer
ko05216 Thyroid cancer
mcc05216 Thyroid cancer
ko05202 Transcriptional misregulation in cancer
mcc05202 Transcriptional misregulation in cancer

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003074 Peroxisome proliferator-activated receptor
IPR022590 Peroxisome proliferator-activated receptor gamma, N-terminal
IPR003077 Peroxisome proliferator-activated receptor, gamma
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
peroxisome proliferator-activated receptor gamma
Protein Entry
PPARG_MACMU
UniProt ID
O18924
Species
Rhesus monkey

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Comment=Additional isoforms seem to exist.; Name=2; IsoId=O18924-1; Sequence=Displayed; Name=1; IsoId=O18924-2; Sequence=VSP_003646;
Enzyme Regulation PDPK1 activates its transcriptional activity independently of its kinase activity.
Function Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proinflammatory responses (By similarity).
Ptm O-GlcNAcylation at Thr-84 reduces transcriptional activity in adipocytes.
Ptm Phosphorylated at basal conditions and dephosphorylated when treated with the ligand. May be dephosphorylated by PPP5C. The phosphorylated form may be inactive and dephosphorylation induces adipogenic activity (By similarity).
Similarity Belongs to the nuclear hormone receptor family. NR1 subfamily.
Similarity Contains 1 nuclear receptor DNA-binding domain.
Subcellular Location Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407}. Cytoplasm Note=Redistributed from the nucleus to the cytosol through a MAP2K1/MEK1-dependent manner. CCRN4L/NOC enhances its nuclear translocation (By similarity).
Subunit Heterodimer with other nuclear receptors, such as RXRA. The heterodimer with the retinoic acid receptor RXRA is called adipocyte-specific transcription factor ARF6. Interacts with NCOA6 coactivator, leading to a strong increase in transcription of target genes. Interacts with coactivator PPARBP, leading to a mild increase in transcription of target genes. Interacts with NOCA7 in a ligand-inducible manner. Interacts with NCOA1 and NCOA2 LXXLL motifs. Interacts with ASXL1, ASXL2, DNTTIP2, FAM120B, MAP2K1/MEK1, NR0B2, PDPK1, PRDM16, PRMT2 and TGFB1I1. Interacts (when activated by agonist) with PPP5C. Interacts with HELZ2 and THRAP3; the interaction stimulates the transcriptional activity of PPARG. Interacts with PER2, the interaction is ligand dependent and blocks PPARG recruitment to target promoters. Interacts with CCRN4L/NOC. Interacts with FOXO1 (acetylated form) (By similarity).
Tissue Specificity Highest expression in adipose tissue. Lower in liver, heart, kidney, stomach, duodenum and colon.

Identical and Related Proteins

Unique RefSeq proteins for LMP014662 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
74136281 RefSeq NP_001028032 505 peroxisome proliferator-activated receptor gamma
74136281 RefSeq NW_001112691 505 peroxisome proliferator-activated receptor gamma

Identical Sequences to LMP014662 proteins

Reference Database Accession Length Protein Name
GI:74136281 GenBank AAB87480.1 505 peroxisome proliferator-activated receptor gamma 2 [Macaca mulatta]
GI:74136281 GenBank AAB87480.1 505 peroxisome proliferator-activated receptor gamma 2 [Macaca mulatta]
GI:74136281 GenBank EHH51133.1 505 hypothetical protein EGM_10463 [Macaca fascicularis]
GI:74136281 GenBank EHH51133.1 505 hypothetical protein EGM_10463 [Macaca fascicularis]
GI:74136281 SwissProt O18924.1 505 RecName: Full=Peroxisome proliferator-activated receptor gamma; Short=PPAR-gamma; AltName: Full=Nuclear receptor subfamily 1 group C member 3 [Macaca mulatta]
GI:74136281 SwissProt O18924.1 505 RecName: Full=Peroxisome proliferator-activated receptor gamma; Short=PPAR-gamma; AltName: Full=Nuclear receptor subfamily 1 group C member 3 [Macaca mulatta]

Related Sequences to LMP014662 proteins

Reference Database Accession Length Protein Name
GI:74136281 RefSeq XP_007983448.1 505 PREDICTED: peroxisome proliferator-activated receptor gamma isoform X1 [Chlorocebus sabaeus]
GI:74136281 RefSeq XP_007983448.1 505 PREDICTED: peroxisome proliferator-activated receptor gamma isoform X1 [Chlorocebus sabaeus]