Gene/Proteome Database (LMPD)
Proteins
protein kinase C epsilon type | |
---|---|
Refseq ID | NP_001244670 |
Protein GI | 383873051 |
UniProt ID | F7BIC2 |
mRNA ID | NM_001257741 |
Length | 736 |
Protein sequence is identical to GI:109102817 (mRNA isoform) |
Refseq ID | XP_001112763 |
Protein GI | 109102817 |
UniProt ID | F7BIC2 |
mRNA ID | XM_001112763 |
Length | 736 |
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKTNSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLEPEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQPTYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVNMPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRSASSPDGQLSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQINQEEFKGFSYFGEDLMP |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
GO:0005739 | IEA:Ensembl | C | mitochondrion |
GO:0005634 | IEA:Ensembl | C | nucleus |
GO:0048471 | IEA:Ensembl | C | perinuclear region of cytoplasm |
GO:0005886 | IEA:Ensembl | C | plasma membrane |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0004699 | IEA:Ensembl | F | calcium-independent protein kinase C activity |
GO:0008047 | IEA:Ensembl | F | enzyme activator activity |
GO:0035276 | IEA:Ensembl | F | ethanol binding |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0030546 | IEA:Ensembl | F | receptor activator activity |
GO:0071361 | IEA:Ensembl | P | cellular response to ethanol |
GO:0071456 | IEA:Ensembl | P | cellular response to hypoxia |
GO:0035556 | IEA:InterPro | P | intracellular signal transduction |
GO:0031663 | IEA:Ensembl | P | lipopolysaccharide-mediated signaling pathway |
GO:0035641 | IEA:Ensembl | P | locomotory exploration behavior |
GO:0002281 | IEA:Ensembl | P | macrophage activation involved in immune response |
GO:0030838 | IEA:Ensembl | P | positive regulation of actin filament polymerization |
GO:0010811 | IEA:Ensembl | P | positive regulation of cell-substrate adhesion |
GO:2001031 | IEA:Ensembl | P | positive regulation of cellular glucuronidation |
GO:0032467 | IEA:Ensembl | P | positive regulation of cytokinesis |
GO:0010634 | IEA:Ensembl | P | positive regulation of epithelial cell migration |
GO:0010763 | IEA:Ensembl | P | positive regulation of fibroblast migration |
GO:0043123 | IEA:Ensembl | P | positive regulation of I-kappaB kinase/NF-kappaB signaling |
GO:0032024 | IEA:Ensembl | P | positive regulation of insulin secretion |
GO:0050996 | IEA:Ensembl | P | positive regulation of lipid catabolic process |
GO:0043410 | IEA:Ensembl | P | positive regulation of MAPK cascade |
GO:0070257 | IEA:Ensembl | P | positive regulation of mucus secretion |
GO:0032230 | IEA:Ensembl | P | positive regulation of synaptic transmission, GABAergic |
GO:0090303 | IEA:Ensembl | P | positive regulation of wound healing |
GO:0061178 | IEA:Ensembl | P | regulation of insulin secretion involved in cellular response to glucose stimulus |
GO:0050730 | IEA:Ensembl | P | regulation of peptidyl-tyrosine phosphorylation |
GO:0051209 | IEA:Ensembl | P | release of sequestered calcium ion into cytosol |
GO:0043278 | IEA:Ensembl | P | response to morphine |
GO:0035669 | IEA:Ensembl | P | TRAM-dependent toll-like receptor 4 signaling pathway |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
ko04022 | cGMP-PKG signaling pathway |
mcc04022 | cGMP-PKG signaling pathway |
ko04666 | Fc gamma R-mediated phagocytosis |
mcc04666 | Fc gamma R-mediated phagocytosis |
ko04750 | Inflammatory mediator regulation of TRP channels |
mcc04750 | Inflammatory mediator regulation of TRP channels |
ko05206 | MicroRNAs in cancer |
mcc05206 | MicroRNAs in cancer |
ko04530 | Tight junction |
mcc04530 | Tight junction |
ko04930 | Type II diabetes mellitus |
mcc04930 | Type II diabetes mellitus |
ko04270 | Vascular smooth muscle contraction |
mcc04270 | Vascular smooth muscle contraction |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR000961 | AGC-kinase, C-terminal |
IPR000008 | C2 domain |
IPR020454 | Diacylglycerol/phorbol-ester binding |
IPR017441 | Protein kinase, ATP binding site |
IPR014376 | Protein kinase C, delta/epsilon/eta/theta types |
IPR002219 | Protein kinase C-like, phorbol ester/diacylglycerol-binding domain |
IPR017892 | Protein kinase, C-terminal |
IPR000719 | Protein kinase domain |
IPR011009 | Protein kinase-like domain |
IPR002290 | Serine/threonine/dual specificity protein kinase, catalytic domain |
IPR008271 | Serine/threonine-protein kinase, active site |
UniProt Annotations
Entry Information
Gene Name
protein kinase C, epsilon
Protein Entry
F7BIC2_MACMU
UniProt ID
Species
Rhesus monkey
Comments
Comment Type | Description |
---|---|
Catalytic Activity | ATP + a protein = ADP + a phosphoprotein. |
Similarity | Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily. |
Similarity | Contains 1 C2 domain. |
Similarity | Contains AGC-kinase C-terminal domain. |
Similarity | Contains protein kinase domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP014695 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109102817 | RefSeq | XP_001112763 | 736 | protein kinase C, epsilon |
Identical Sequences to LMP014695 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383873051 | GenBank | EHH55543.1 | 736 | hypothetical protein EGM_04773 [Macaca fascicularis] |
GI:383873051 | GenBank | AFE79190.1 | 736 | protein kinase C epsilon type [Macaca mulatta] |
GI:383873051 | RefSeq | XP_005576025.1 | 736 | PREDICTED: protein kinase C epsilon type isoform X1 [Macaca fascicularis] |
GI:383873051 | RefSeq | XP_007968950.1 | 736 | PREDICTED: protein kinase C epsilon type [Chlorocebus sabaeus] |
Related Sequences to LMP014695 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:383873051 | GenBank | EHH22097.1 | 736 | hypothetical protein EGK_05295 [Macaca mulatta] |