Gene/Proteome Database (LMPD)

LMPD ID
LMP014728
Gene ID
Species
Macaca mulatta (Rhesus monkey)
Gene Name
prostaglandin E synthase
Gene Symbol
Alternate Names
prostaglandin E synthase;
Chromosome
15
Map Location
chromosome:15

Proteins

prostaglandin E synthase
Refseq ID NP_001248097
Protein GI 386781181
UniProt ID G7NFJ9
mRNA ID NM_001261168
Length 152
Protein sequence is identical to GI:109110034 (mRNA isoform)
Refseq ID XP_001107574
Protein GI 109110034
UniProt ID G7NFJ9
mRNA ID XM_001107574
Length 152
MPAHSLAMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLLGRVVHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL

Gene Information

Entrez Gene ID
Gene Name
prostaglandin E synthase
Gene Symbol
Species
Macaca mulatta

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:Ensembl C cytoplasm
GO:0016021 IEA:Ensembl C integral component of membrane
GO:0005641 IEA:Ensembl C nuclear envelope lumen
GO:0043295 IEA:Ensembl F glutathione binding
GO:0050220 IEA:Ensembl F prostaglandin-E synthase activity
GO:0008285 IEA:Ensembl P negative regulation of cell proliferation
GO:0001516 IEA:Ensembl P prostaglandin biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
mcc00590 Arachidonic acid metabolism
mcc01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR023352 Membrane associated eicosanoid/glutathione metabolism-like domain
IPR001129 Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) protein

UniProt Annotations

Entry Information

Gene Name
prostaglandin E synthase
Protein Entry
G7NFJ9_MACMU
UniProt ID
Species
Rhesus monkey

Identical and Related Proteins

Unique RefSeq proteins for LMP014728 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
109110034 RefSeq XP_001107574 152 prostaglandin E synthase

Identical Sequences to LMP014728 proteins

Reference Database Accession Length Protein Name
GI:386781181 GenBank AFH34732.1 152 prostaglandin E synthase [Macaca mulatta]
GI:386781181 RefSeq XP_003911250.1 152 PREDICTED: prostaglandin E synthase [Papio anubis]
GI:386781181 RefSeq XP_008004152.1 152 PREDICTED: prostaglandin E synthase [Chlorocebus sabaeus]
GI:386781181 RefSeq XP_010359233.1 152 PREDICTED: prostaglandin E synthase [Rhinopithecus roxellana]

Related Sequences to LMP014728 proteins

Reference Database Accession Length Protein Name
GI:386781181 GenBank EHH23748.1 152 hypothetical protein EGK_07286 [Macaca mulatta]
GI:386781181 RefSeq XP_003264284.1 152 PREDICTED: prostaglandin E synthase [Nomascus leucogenys]
GI:386781181 SwissProt Q6PWL6.1 152 RecName: Full=Prostaglandin E synthase; AltName: Full=Microsomal glutathione S-transferase 1-like 1; Short=MGST1-L1; AltName: Full=Microsomal prostaglandin E synthase 1; Short=MPGES-1 [Macaca fascicularis]