Gene/Proteome Database (LMPD)
Proteins
prostaglandin E synthase 3 | |
---|---|
Refseq ID | NP_001248443 |
Protein GI | 387763009 |
UniProt ID | F6Q847 |
mRNA ID | NM_001261514 |
Length | 160 |
Protein sequence is identical to GI:109097318 (mRNA isoform) |
Refseq ID | XP_001115388 |
Protein GI | 109097318 |
UniProt ID | F6Q847 |
mRNA ID | XM_002798629 |
Length | 160 |
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
Refseq ID | XP_002798675 |
Protein GI | 297262713 |
UniProt ID | F6Q847 |
mRNA ID | XM_002798629 |
Length | 127 |
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
Refseq ID | XP_002798674 |
Protein GI | 297262711 |
UniProt ID | F6Q847 |
mRNA ID | XM_002798629 |
Length | 124 |
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin E synthase 3 (cytosolic)
Gene Symbol
Species
Macaca mulatta
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008283 | IEA:Ensembl | P | cell proliferation |
GO:0042921 | IEA:Ensembl | P | glucocorticoid receptor signaling pathway |
GO:0005978 | IEA:Ensembl | P | glycogen biosynthetic process |
GO:0060430 | IEA:Ensembl | P | lung saccule development |
GO:0043588 | IEA:Ensembl | P | skin development |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin E synthase 3 (cytosolic)
Protein Entry
F6Q847_MACMU
UniProt ID
Species
Rhesus monkey
Identical and Related Proteins
Unique RefSeq proteins for LMP014730 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
109097318 | RefSeq | XP_001115388 | 160 | prostaglandin E synthase 3 (cytosolic) |
297262713 | RefSeq | XP_002798675 | 127 | prostaglandin E synthase 3 (cytosolic) |
297262711 | RefSeq | XP_002798674 | 124 | prostaglandin E synthase 3 (cytosolic) |
Identical Sequences to LMP014730 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:387763009 | RefSeq | XP_002711223.2 | 160 | PREDICTED: prostaglandin E synthase 3 isoform X2 [Oryctolagus cuniculus] |
GI:387763009 | RefSeq | XP_008681905.1 | 160 | PREDICTED: prostaglandin E synthase 3 [Ursus maritimus] |
GI:387763009 | RefSeq | XP_010376073.1 | 160 | PREDICTED: prostaglandin E synthase 3 [Rhinopithecus roxellana] |
GI:387763009 | RefSeq | XP_010642954.1 | 160 | PREDICTED: prostaglandin E synthase 3 [Fukomys damarensis] |
Related Sequences to LMP014730 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:387763009 | GenBank | AAH03005.1 | 160 | Prostaglandin E synthase 3 (cytosolic) [Homo sapiens] |
GI:387763009 | GenBank | JAA05265.1 | 160 | prostaglandin E synthase 3 (cytosolic) [Pan troglodytes] |
GI:387763009 | GenBank | JAA15741.1 | 160 | prostaglandin E synthase 3 (cytosolic) [Pan troglodytes] |
GI:387763009 | GenBank | JAA15742.1 | 160 | prostaglandin E synthase 3 (cytosolic) [Pan troglodytes] |